TkA01G615900 | RubberDandelionOmics

Gene overview

TkA01G615900

Reference: TK1151 Chr: Chr01 Coordinates: 155363305-155368342 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

820 bp · TkA01G615900|TK1151|cDNA

CAGATTGAAATATTTATGTGATCGAGCCTCGCGATATAAATTGGTCTAGGGTTTTAACTTCATCCGCCGTTTATTGAACAATATTGATTAGGTAAGACATAGCCGCCGCCGCCGTCGCCGGAGTAGTTCCGTGATATTTACAGAAAAAAGGAGATGGCGTATGCAGCTATGAAACCAACAAAACCAGGGCTAGAAGAGCCTCAAGAACAGCTTCACAAGATCAGAATTACTCTCTCGTCCAAGAATGTTAAGAATCTAGA...

CDS

Download CDS FASTA

369 bp · TkA01G615900|TK1151|CDS

ATGGCGTATGCAGCTATGAAACCAACAAAACCAGGGCTAGAAGAGCCTCAAGAACAGCTTCACAAGATCAGAATTACTCTCTCGTCCAAGAATGTTAAGAATCTAGAGAAAGTGTGTGCTGATTTGGTACGTGGTGCAAAGGACAAGAAGTTGAGGGTGAAGGGACCAGTTAGAATGCCTACAAAGGTTCTCAATATCACAACCAGAAAGTCTCCTTGTGGTGAAGGAACAAACACATGGGACAGATTTGAGCTTCGAGT...

Protein

Download Protein FASTA

122 aa · TkA01G615900|TK1151|PROTEIN

MAYAAMKPTKPGLEEPQEQLHKIRITLSSKNVKNLEKVCADLVRGAKDKKLRVKGPVRMPTKVLNITTRKSPCGEGTNTWDRFELRVHKRVIDLFSSPDVVKQITSITIEPGVEVEVTIADN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G615900`
TK1151 ID	TkA01G615900
OH-1004 ID	LXL04_000383
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 45.018 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G615900

Location Chr01:155363305-155368342 (+)

Description Similar to RPS20B: 40S ribosomal protein S20-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47370`	Small ribosomal subunit protein uS10y.	No verified direct reference in this release
`UniProt: P49200`	Small ribosomal subunit protein uS10z/uS10x.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0134000`	Small ribosomal subunit protein uS10.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000383 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT3G45030

ath:AT3G47370

ath:AT5G62300

dosa:Os06g0134000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.831

Rank 1 · TkA01G615900 · TK1151

Nucleus0.258

Rank 2 · TkA01G615900 · TK1151

Endoplasmic reticulum0.083

Rank 3 · TkA01G615900 · TK1151

Mitochondrion0.055

Rank 4 · TkA01G615900 · TK1151

Cell membrane0.031

Rank 5 · TkA01G615900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00338Ribosomal_S1024-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G615900	`PF00338`	Ribosomal_S10	24	118	5e-29	101.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STY6`	Arabidopsis thaliana	sp\|Q9STY6\|RS202_ARATH Small ribosomal subunit protein uS10y	91.000%	Swiss-Prot	High
`P49200`	Arabidopsis thaliana	sp\|P49200\|RS201_ARATH Small ribosomal subunit protein uS10z/uS10x	90.900%	Swiss-Prot	High
`P35686`	Oryza sativa subsp. japonica	sp\|P35686\|RS20_ORYSJ Small ribosomal subunit protein uS10	82.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card