TkA01G599870 | RubberDandelionOmics

Gene overview

TkA01G599870

Reference: TK1151 Chr: Chr01 Coordinates: 151090354-151091746 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1040 bp · TkA01G599870|TK1151|cDNA

CTAGCTTCTTCCTATTCTAATTTCACCGCCTCAGGCCTCTCTCCCCATCTACGGGTGCCAGCCACGGTGGCGCTTCAGGCTCTCATTGGAGGCTTCTCGGAGCTCCGGCGACGCTTTTACTCTCTTTCTGAATATCACTCTCGATTTCTTCTCATTTCGCTTTATCTCTCGTGCCTTTTCCGTTAATCCTGTTACAATCAACTGTTAAACGTTTAAAGAAATGACAGAAATATTCAACGATTCATCTCAAAGACAACTAT...

CDS

Download CDS FASTA

420 bp · TkA01G599870|TK1151|CDS

ATGTCACGGAAAATCAAAAGTAACCATCGCGTCTCTTCTAATCAGCAAAGACCTCTTAGCAATGATCTTATCCATGCTAGAATACCTCCTAGAGCTCCACTTCTTCCCCAATTTAAAACCAATTGGTCAATAAGCAACATCGGATTCACGTTAGTAATCCTAGGCGAAACAATAAGAAAACTCGCCATTTTGACAGCCGGAAGAGCTTTTACTCATTTCATTCAACAATACCACGAAGATCATCATAAACTAATCACTTA...

Protein

Download Protein FASTA

139 aa · TkA01G599870|TK1151|PROTEIN

MSRKIKSNHRVSSNQQRPLSNDLIHARIPPRAPLLPQFKTNWSISNIGFTLVILGETIRKLAILTAGRAFTHFIQQYHEDHHKLITYGIYGVIRHPGYSGFLIWSVGTQIMLCNPLSSVAFAVVVWTSFVKEFRMRSFF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G599870`
TK1151 ID	TkA01G599870
OH-1004 ID	LXL04_036367
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.200
Protein coverage (%)	TK1151 74.820 / OH-1004 19.569 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G599870

Location Chr01:151090354-151091746 (-)

Description Similar to ICMTB: Protein-S-isoprenylcysteine O-methyltransferase B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08335`	Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues, resulting in the modulation of the function of prenylated proteins.	Prenylcysteine alpha-carboxyl methyltransferase expression and function in Arabidopsis thaliana.2002 · DOI: 10.1046/j.1365-313x.2002.01463.x
`At5g23320`	Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues, resulting in the modulation of the function of prenylated proteins.	Identification and functional expression in yeast of a prenylcysteine alpha-carboxyl methyltransferase gene from Arabidopsis thaliana.2001 · DOI: 10.1023/a:1010671202925 Prenylcysteine alpha-carboxyl methyltransferase expression and function in Arabidopsis thaliana.2002 · DOI: 10.1046/j.1365-313x.2002.01463.x

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XX73`	Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.	No verified direct reference in this release
`Os04g0602900`	Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036367 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006481 C-terminal protein methylation Biological Process

GO:0006612 protein targeting to membrane Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0032259 methylation Biological Process

GO:0036211 protein modification process Biological Process

GO:0046498 S-adenosylhomocysteine metabolic process Biological Process

GO:0046499 S-adenosylmethioninamine metabolic process Biological Process

GO:0048367 shoot system development Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G08335

ath:AT5G23320

dosa:Os04g0602900

hsa:23463

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.784

Rank 1 · TkA01G599870 · TK1151

Nucleus0.077

Rank 2 · TkA01G599870 · TK1151

Cytoplasm0.076

Rank 3 · TkA01G599870 · TK1151

Mitochondrion0.054

Rank 4 · TkA01G599870 · TK1151

Cell membrane0.048

Rank 5 · TkA01G599870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04191PEMT47-129 aa

PF04140ICMT50-129 aa

PF07298NnrU57-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G599870	`PF04191`	PEMT	47	129	6.1e-09	37.0
TkA01G599870	`PF04140`	ICMT	50	129	1.8e-20	73.9
TkA01G599870	`PF07298`	NnrU	57	119	0.025	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93W54`	Arabidopsis thaliana	sp\|Q93W54\|ICMTB_ARATH Protein-S-isoprenylcysteine O-methyltransferase B	62.900%	Swiss-Prot	Medium
`Q9FMW9`	Arabidopsis thaliana	sp\|Q9FMW9\|ICMTA_ARATH Protein-S-isoprenylcysteine O-methyltransferase A	56.600%	Swiss-Prot	High
`A2XX73`	Oryza sativa subsp. indica	sp\|A2XX73\|ICMT_ORYSI Probable protein-S-isoprenylcysteine O-methyltransferase	59.300%	Swiss-Prot	High
`Q7XSR9`	Oryza sativa subsp. japonica	sp\|Q7XSR9\|ICMT_ORYSJ Probable protein-S-isoprenylcysteine O-methyltransferase	59.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card