LXL04_036367 | RubberDandelionOmics

Gene overview

LXL04_036367

Reference: OH-1004 Chr: Chr08 Coordinates: 40874350-40880643 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1674 bp · LXL04_036367|LXL04_036367|OH1004|cDNA

ATGGATGTGACGGGACGGAGCAAACAACGACATGGAAGAAGAGCGGAGGGAATCAATCTGATGGATGCGACGGGACTGAGCAAACAGGGGAAGGATAAGAGGTCGGAATGCATCGATGGAGAAGAAAGAGGGAACAGGAGAAGGATAAGGAGAAGAAACGATTGTCCTAACGATAATAGGGATGAGCAGAAACTGCAAGTACCTGAACTGAGAACTGAAACTGCCACGGAACTGGCAATTCTAGAACTGGAACTGCCTCA...

CDS

Download CDS FASTA

1674 bp · LXL04_036367|LXL04_036367|OH1004|CDS

ATGGATGTGACGGGACGGAGCAAACAACGACATGGAAGAAGAGCGGAGGGAATCAATCTGATGGATGCGACGGGACTGAGCAAACAGGGGAAGGATAAGAGGTCGGAATGCATCGATGGAGAAGAAAGAGGGAACAGGAGAAGGATAAGGAGAAGAAACGATTGTCCTAACGATAATAGGGATGAGCAGAAACTGCAAGTACCTGAACTGAGAACTGAAACTGCCACGGAACTGGCAATTCTAGAACTGGAACTGCCTCA...

Protein

Download Protein FASTA

557 aa · LXL04_036367|LXL04_036367|OH1004|PROTEIN

MDVTGRSKQRHGRRAEGINLMDATGLSKQGKDKRSECIDGEERGNRRRIRRRNDCPNDNRDEQKLQVPELRTETATELAILELELPQASPVPIPNIRELPSAIPVPIPNNSGSATCRIYKSSRLHFGSATIGPSSSSNRRPQIHHRSFFIFKSALRHFELLLHLQIGDDRSFFIFKSATTDYTYSHADSSSPPSSSFSIFNSHADGIQPVSTIDSSLIRFNFTDPPSAIARRSLAFAILDSIQTHHRLLVHVHSRFRSKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036367`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036367

Location Chr08:40874350-40880643 (-)

Description Similar to ICMTB: Protein-S-isoprenylcysteine O-methyltransferase B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08335`	Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues, resulting in the modulation of the function of prenylated proteins.	Prenylcysteine alpha-carboxyl methyltransferase expression and function in Arabidopsis thaliana.2002 · DOI: 10.1046/j.1365-313x.2002.01463.x
`At5g23320`	Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues, resulting in the modulation of the function of prenylated proteins.	Identification and functional expression in yeast of a prenylcysteine alpha-carboxyl methyltransferase gene from Arabidopsis thaliana.2001 · DOI: 10.1023/a:1010671202925 Prenylcysteine alpha-carboxyl methyltransferase expression and function in Arabidopsis thaliana.2002 · DOI: 10.1046/j.1365-313x.2002.01463.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0602900`	Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.	No verified direct reference in this release
`UniProt: A2XX73`	Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036367 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006481 C-terminal protein methylation Biological Process

GO:0006612 protein targeting to membrane Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0032259 methylation Biological Process

GO:0036211 protein modification process Biological Process

GO:0046498 S-adenosylhomocysteine metabolic process Biological Process

GO:0046499 S-adenosylmethioninamine metabolic process Biological Process

GO:0048367 shoot system development Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G08335

ath:AT5G23320

dosa:Os04g0602900

hsa:23463

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.375

Rank 1 · LXL04_036367 · OH-1004

Nucleus0.233

Rank 2 · LXL04_036367 · OH-1004

Cytoplasm0.219

Rank 3 · LXL04_036367 · OH-1004

Cell membrane0.149

Rank 4 · LXL04_036367 · OH-1004

Golgi apparatus0.102

Rank 5 · LXL04_036367 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04191.19PEMT392-489 aa

PF04140.20ICMT393-485 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036367	`PF04191.19`	PEMT	392	489	7.4e-11	43.1
LXL04_036367	`PF04140.20`	ICMT	393	485	4.3e-27	95.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93W54`	Arabidopsis thaliana	Protein-S-isoprenylcysteine O-methyltransferase B	69.231%	Swiss-Prot	weak database homology
`Q9FMW9`	Arabidopsis thaliana	Protein-S-isoprenylcysteine O-methyltransferase A	67.692%	Swiss-Prot	weak database homology
`Q7XSR9`	Oryza sativa subsp. japonica	Probable protein-S-isoprenylcysteine O-methyltransferase	62.570%	Swiss-Prot	weak database homology
`A2XX73`	Oryza sativa subsp. indica	Probable protein-S-isoprenylcysteine O-methyltransferase	62.570%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card