TkA01G586560 | RubberDandelionOmics

Gene overview

TkA01G586560

Reference: TK1151 Chr: Chr01 Coordinates: 147534873-147537001 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1962 bp · TkA01G586560|TK1151|cDNA

CATAGATCATAACTTTTCATTCATGACCTCAGACTTTTTCAACCAGATTAAGAGTCTCCCTGACTCCATATCTTTATTCTAACCCACTTTAACAAGACCTTTAACAATTCCACCAACACACTTTTACATGTCTTCCCCTTCACAATTACCCAAATCAAATCCCTATTCATCCATTCGCCAACGGTATAATTTAATCCTCTTTCTCCTTATTTAATTCCTCATCTGCTTCCGCTTCTTCTGCTATTCCTCCATTACATTTC...

CDS

Download CDS FASTA

1410 bp · TkA01G586560|TK1151|CDS

ATGGACCATACCCAGAGAATGGGTTTAATCTGGTTCATACCCATTTTCTGTTTCCTGTTTTCTACATCTAGTGCAGCGATTGCAGCAAAACCAGGGGTAAACTATGGTCAACTCGGAAATAACCTCCCTCATCCAAGCAAATCGGTGGAGCTCATCAAATCCCTAAAAGCCGGCCGTGTTAAGATCTACGATGCGAACCCGAAAATCCTTCAGGCACTTGCGAACACCAATATTCAAGTATCGATAATGGTGCCTAATGA...

Protein

Download Protein FASTA

469 aa · TkA01G586560|TK1151|PROTEIN

MDHTQRMGLIWFIPIFCFLFSTSSAAIAAKPGVNYGQLGNNLPHPSKSVELIKSLKAGRVKIYDANPKILQALANTNIQVSIMVPNEIITAMAPNQSLADEWVRTNVVPFYPKTMIRYVLVGNEILSQPDNVTWFNLVPAMRRIRKALVSHKLKKIKVGTPLAMDCLEASFPPSSGKFRSSVSESVLKPLLQFIYRTKSFFFIDVYTYFAWISDPVNIKLDYALLQPNASTYTDPVTGLLYTNMLEQMLDALYFAMKDAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G586560`
TK1151 ID	TkA01G586560
OH-1004 ID	LXL04_000800
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 99.360 / OH-1004 89.615 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G586560

Location Chr01:147534873-147537001 (-)

Description Similar to A6: Probable glucan endo-1,3-beta-glucosidase A6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14080`	Probable beta-1,3-glucanase that may be involved in the degradation of callose walls around the microspore tetrad during pollen development (Probable).	No verified direct reference in this release
`At4g29360`	Glucan endo-1,3-beta-glucosidase 12.	No verified direct reference in this release
`At5g56590`	Glucan endo-1,3-beta-glucosidase 13.	No verified direct reference in this release
`At3g13560`	Glucan endo-1,3-beta-glucosidase 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000800 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006076 (1->3)-beta-D-glucan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G66250

ath:AT4G14080

ath:AT4G29360

ath:AT5G56590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.417

Rank 1 · TkA01G586560 · TK1151

Cell membrane0.266

Rank 2 · TkA01G586560 · TK1151

Endoplasmic reticulum0.096

Rank 3 · TkA01G586560 · TK1151

Cytoplasm0.085

Rank 4 · TkA01G586560 · TK1151

Lysosome / Vacuole0.083

Rank 5 · TkA01G586560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332Glyco_hydro_1732-352 aa

PF29664BtgE-BtgC_glyc-hydro48-160 aa

PF08265YL1_C112-118 aa

PF08265YL1_C232-243 aa

PF29664BtgE-BtgC_glyc-hydro259-339 aa

PF07983X8379-451 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G586560	`PF00332`	Glyco_hydro_17	32	352	1.5e-91	307.9
TkA01G586560	`PF29664`	BtgE-BtgC_glyc-hydro	48	160	1.8e-09	37.9
TkA01G586560	`PF08265`	YL1_C	112	118	0.13	12.8
TkA01G586560	`PF08265`	YL1_C	232	243	0.13	12.8
TkA01G586560	`PF29664`	BtgE-BtgC_glyc-hydro	259	339	1.8e-09	37.9
TkA01G586560	`PF07983`	X8	379	451	2.6e-18	67.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q06915`	Arabidopsis thaliana	sp\|Q06915\|EA6_ARATH Probable glucan endo-1,3-beta-glucosidase A6	55.800%	Swiss-Prot	High
`Q8VYE5`	Arabidopsis thaliana	sp\|Q8VYE5\|E1312_ARATH Glucan endo-1,3-beta-glucosidase 12	38.000%	Swiss-Prot	Medium
`Q9FJU9`	Arabidopsis thaliana	sp\|Q9FJU9\|E1313_ARATH Glucan endo-1,3-beta-glucosidase 13	39.200%	Swiss-Prot	Medium
`Q94CD8`	Arabidopsis thaliana	sp\|Q94CD8\|E134_ARATH Glucan endo-1,3-beta-glucosidase 4	35.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card