TkA01G585140 | RubberDandelionOmics

Gene overview

TkA01G585140

Reference: TK1151 Chr: Chr01 Coordinates: 147148928-147150124 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

638 bp · TkA01G585140|TK1151|cDNA

AAAAACTGTAGTTTTATTATAAATAAGGAAAGCGGAGAGTAATGAGGAGATAGAGGTTGCCGTGTCAATTTTATCCAATTTTCCAGTTCCAGTTGATCGCTATCGGAATCGATATCAGAGGTGGAGTGGAGATGGGAAAATCTACTGCGTTCAAGGAAACTTATTCATTTGAGGAGCGATGCCAGGAATCACAGGACATCATCGCCAGATATCCCGATCGTTTACCTGTGGTGGCGGAAAGATATACTAAAACCGACCTC...

CDS

Download CDS FASTA

375 bp · TkA01G585140|TK1151|CDS

ATGGGAAAATCTACTGCGTTCAAGGAAACTTATTCATTTGAGGAGCGATGCCAGGAATCACAGGACATCATCGCCAGATATCCCGATCGTTTACCTGTGGTGGCGGAAAGATATACTAAAACCGACCTCCCTGAGATGGAGAAGAAAAAATATTTGGTACCCCGGGACATGTCAGTGGGGCAGTTTATTCACATACTTGGTGGCAGGCTCCATTTGTCTCCTGGGAAGGCTCTGTTCATATTCGTGAACAACACATTACC...

Protein

Download Protein FASTA

124 aa · TkA01G585140|TK1151|PROTEIN

MGKSTAFKETYSFEERCQESQDIIARYPDRLPVVAERYTKTDLPEMEKKKYLVPRDMSVGQFIHILGGRLHLSPGKALFIFVNNTLPQTSSVIESVYESFKDEDGFLYMCYSSEKTFGNMTCDC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G585140`
TK1151 ID	TkA01G585140
OH-1004 ID	LXL04_027071
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	50.900
Protein coverage (%)	TK1151 91.935 / OH-1004 82.609 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G585140

Location Chr01:147148928-147150124 (+)

Description Similar to ATG8CL: Autophagy-related protein 8C-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15580`	Ubiquitin-like modifier involved in autophagosomes formation.	No verified direct reference in this release
`At3g06420`	Ubiquitin-like modifier involved in autophagosomes formation.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0100100`	Ubiquitin-like modifier involved in autophagosomes formation.	No verified direct reference in this release
`UniProt: Q2XPP5`	Ubiquitin-like modifier involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation.	No verified direct reference in this release
`Os07g0512200`	Ubiquitin-like modifier involved in autophagosomes formation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027071 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000423 mitophagy Biological Process

GO:0006914 autophagy Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0015031 protein transport Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0097352 autophagosome maturation Biological Process

GO:0000421 autophagosome membrane Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

KEGG gene cross-reference

dosa:Os04g0624000

dosa:Os08g0191600

osa:4337052

sot:102578628

sot:102593150

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.609

Rank 1 · TkA01G585140 · TK1151

Nucleus0.214

Rank 2 · TkA01G585140 · TK1151

Lysosome / Vacuole0.214

Rank 3 · TkA01G585140 · TK1151

Golgi apparatus0.110

Rank 4 · TkA01G585140 · TK1151

Cell membrane0.104

Rank 5 · TkA01G585140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02991ATG815-118 aa

PF04110APG1241-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G585140	`PF02991`	ATG8	15	118	2.5e-43	147.2
TkA01G585140	`PF04110`	APG12	41	118	3.5e-07	31.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LRP7`	Arabidopsis thaliana	sp\|Q9LRP7\|ATG8I_ARATH Autophagy-related protein 8i	73.500%	Swiss-Prot	High
`Q8S925`	Arabidopsis thaliana	sp\|Q8S925\|ATG8H_ARATH Autophagy-related protein 8h	64.600%	Swiss-Prot	High
`Q2RBS4`	Oryza sativa subsp. japonica	sp\|Q2RBS4\|ATG8D_ORYSJ Autophagy-related protein 8D	66.700%	Swiss-Prot	High
`Q2XPP5`	Oryza sativa subsp. indica	sp\|Q2XPP5\|ATG8A_ORYSI Autophagy-related protein 8A	54.800%	Swiss-Prot	High
`Q69RC4`	Oryza sativa subsp. japonica	sp\|Q69RC4\|ATG8A_ORYSJ Autophagy-related protein 8A	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card