TkA01G581430 | RubberDandelionOmics

Gene overview

TkA01G581430

Reference: TK1151 Chr: Chr01 Coordinates: 146309975-146313663 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3008 bp · TkA01G581430|TK1151|cDNA

ATAGCAACATATTATATATAATATGTCGAGAAGCAGACCCTTCAACCCATCTACTATATATATATATTAAATATAGCAAATTTTAAATTATTTTAAAAACTTTGAAAGAATATGACGACGGATACGATGGGCGTCCTAGTTTATAGTGCTTTATAGGAGCAGACTTTGTTTCTCTCTGGAATCTTTAGATCCACAACAACTCCACAAGCTTGATTATCTCAGGCTACCATTTTCAATCATCATGAATCAGGTGGTGGTAT...

CDS

Download CDS FASTA

1371 bp · TkA01G581430|TK1151|CDS

ATGAATCAGGTGGTGGTATTGCCATATCCAGGAAGAGGTCACATAAACCCTATCTTGAACTTCTGTCACTTGCTATCTTCTCGATTGAGCCAACTTAATCGTACCGCCATCTTCACCGTCGTCGTCACCGAGGAGTGGTTGAGATTTCTTGATCCAGACACGAAGCAAGCTAACGTTCGGTTTGCTACTATCCCTAACGTCCTCCCTTCCGAGCTCAATCGTGGCTCCGACATGATCACCTTCCTCACCGCTGTTAAAAC...

Protein

Download Protein FASTA

456 aa · TkA01G581430|TK1151|PROTEIN

MNQVVVLPYPGRGHINPILNFCHLLSSRLSQLNRTAIFTVVVTEEWLRFLDPDTKQANVRFATIPNVLPSELNRGSDMITFLTAVKTKMERPFEDVLDQISMTQPVSLIIADASMLWPFEVANRRKIPVAAYWPMSASMFSVLHHVDLLESHHHLYLNESERGHEHIDYIPGIPSLTVADIPTVFHAKFGELFKGLVPNLIEVTSKANYVLLSTNYELESEVIDPLRSKIQIPIYTCGLNLPSLKPKLESYTPINWLDSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G581430`
TK1151 ID	TkA01G581430
OH-1004 ID	LXL04_000835
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.700
Protein coverage (%)	TK1151 94.298 / OH-1004 98.405 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G581430

Location Chr01:146309975-146313663 (+)

Description Similar to UGT87A1: UDP-glycosyltransferase 87A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30140`	UDP-glycosyltransferase 87A2.	No verified direct reference in this release
`At2g30150`	UDP-glycosyltransferase 87A1.	No verified direct reference in this release
`At2g28080`	UDP-glycosyltransferase 86A2.	No verified direct reference in this release
`At1g22340`	UDP-glycosyltransferase 85A7.	No verified direct reference in this release
`At1g78270`	UDP-glycosyltransferase 85A4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000835 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009909 regulation of flower development Biological Process

GO:1900994 (-)-secologanin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:BAK55749

ath:AT2G28080

ath:AT2G30140

ath:AT2G30150

ath:AT2G36970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.769

Rank 1 · TkA01G581430 · TK1151

Nucleus0.230

Rank 2 · TkA01G581430 · TK1151

Peroxisome0.077

Rank 3 · TkA01G581430 · TK1151

Endoplasmic reticulum0.057

Rank 4 · TkA01G581430 · TK1151

Cell membrane0.046

Rank 5 · TkA01G581430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26168Glyco_transf_N4-147 aa

PF00201UDPGT31-87 aa

PF26168Glyco_transf_N210-228 aa

PF00201UDPGT258-374 aa

PF06722EryCIII-like_C325-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G581430	`PF26168`	Glyco_transf_N	4	147	4.7e-05	24.1
TkA01G581430	`PF00201`	UDPGT	31	87	3.7e-19	69.7
TkA01G581430	`PF26168`	Glyco_transf_N	210	228	4.7e-05	24.1
TkA01G581430	`PF00201`	UDPGT	258	374	3.7e-19	69.7
TkA01G581430	`PF06722`	EryCIII-like_C	325	403	0.046	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64733`	Arabidopsis thaliana	sp\|O64733\|U87A2_ARATH UDP-glycosyltransferase 87A2	46.200%	Swiss-Prot	Medium
`O64732`	Arabidopsis thaliana	sp\|O64732\|U87A1_ARATH UDP-glycosyltransferase 87A1	43.300%	Swiss-Prot	Medium
`Q9ZUV0`	Arabidopsis thaliana	sp\|Q9ZUV0\|U86A2_ARATH UDP-glycosyltransferase 86A2	31.200%	Swiss-Prot	Medium
`Q9LME8`	Arabidopsis thaliana	sp\|Q9LME8\|U85A7_ARATH UDP-glycosyltransferase 85A7	31.300%	Swiss-Prot	Medium
`Q9M9E7`	Arabidopsis thaliana	sp\|Q9M9E7\|U85A4_ARATH UDP-glycosyltransferase 85A4	33.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card