LXL04_000835 | RubberDandelionOmics

Gene overview

LXL04_000835

Reference: OH-1004 Chr: Chr01 Coordinates: 15467427-15468953 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1370 bp · LXL04_000835|LXL04_000835|OH1004|cDNA

ATGAATCAAGTGGTGGTAGTGCCATATCCAGGAAGAAGCCACATAAACAGTCTGTTGAACTTCTGTCACTCACTATCTTCTCGATTGAACCAACCTAATCGCACCACCATCTTCACGGTCGTCGTCACCGAGGAGTGGCTGGGATTTCTCGATCCAGACCAGAAGCAAGCTACCATTCGGTTTGCTACTATCCCTAACGTCCTCCCTTTAGAGGTCAACCGTGGCACTGACATAATCACCTTCCTCACCGCTGTTACAAC...

CDS

Download CDS FASTA

1320 bp · LXL04_000835|LXL04_000835|OH1004|CDS

ATGAATCAAGTGGTGGTAGTGCCATATCCAGGAAGAAGCCACATAAACAGTCTGTTGAACTTCTGTCACTCACTATCTTCTCGATTGAACCAACCTAATCGCACCACCATCTTCACGGTCGTCGTCACCGAGGAGTGGCTGGGATTTCTCGATCCAGACCAGAAGCAAGCTACCATTCGGTTTGCTACTATCCCTAACGTCCTCCCTTTAGAGGTCAACCGTGGCACTGACATAATCACCTTCCTCACCGCTGTTACAAC...

Protein

Download Protein FASTA

439 aa · LXL04_000835|LXL04_000835|OH1004|PROTEIN

MNQVVVVPYPGRSHINSLLNFCHSLSSRLNQPNRTTIFTVVVTEEWLGFLDPDQKQATIRFATIPNVLPLEVNRGTDIITFLTAVTTKMERPFEEVLDKMELPVALVIADSTMFWPFEVANRRNIPVAAYWPLSASMFSVLHHADLLKSHHHLYLDESERGHEHIDYIPGVPSLTIADFPMFFHAKFGQLFKGFVPNLLEVTNKANYVLLSTIYDLESKAIDALRSKIQAPIYTCGLNIPSSKPKLDSNNPINWLDSKPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000835`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000835

Location Chr01:15467427-15468953 (+)

Description Similar to UGT87A1: UDP-glycosyltransferase 87A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30150`	UDP-glycosyltransferase 87A1.	No verified direct reference in this release
`At2g30140`	UDP-glycosyltransferase 87A2.	No verified direct reference in this release
`At2g28080`	UDP-glycosyltransferase 86A2.	No verified direct reference in this release
`At2g36970`	UDP-glycosyltransferase 86A1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000835 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009909 regulation of flower development Biological Process

GO:1900994 (-)-secologanin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:BAK55749

ath:AT2G28080

ath:AT2G30140

ath:AT2G30150

ath:AT2G36970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.778

Rank 1 · LXL04_000835 · OH-1004

Nucleus0.210

Rank 2 · LXL04_000835 · OH-1004

Peroxisome0.082

Rank 3 · LXL04_000835 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_000835 · OH-1004

Mitochondrion0.044

Rank 5 · LXL04_000835 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT232-400 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000835	`PF00201.25`	UDPGT	232	400	5.3e-22	79.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64732`	Arabidopsis thaliana	UDP-glycosyltransferase 87A1	46.154%	Swiss-Prot	moderate database homology
`O64733`	Arabidopsis thaliana	UDP-glycosyltransferase 87A2	44.643%	Swiss-Prot	moderate database homology
`Q9ZUV0`	Arabidopsis thaliana	UDP-glycosyltransferase 86A2	31.659%	Swiss-Prot	moderate database homology
`Q9SJL0`	Arabidopsis thaliana	UDP-glycosyltransferase 86A1	26.850%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card