TkA01G578190 | RubberDandelionOmics

Gene overview

TkA01G578190

Reference: TK1151 Chr: Chr01 Coordinates: 145379338-145381868 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1494 bp · TkA01G578190|TK1151|cDNA

AAAAAAACAAACAAAATCTTAAACTAATTTTTCAAGGATTTGCCGTGCAAGGACTCGTCGACCTAAATCAAAAATGTCGACTGCAACATCACTCCTTAGCTCTTCACCCATCATCTTCCGGACCACCACCACCACCGCCACCACCAGCATCACCACCGTCCCACCACTGAAATTCAGACCCAAAAAACTCCGTCAATCTGCACCCAGAATGTCCATCAACAACTCTCCTCCAACCCCCACTCAACTCATCACCTCCATCA...

CDS

Download CDS FASTA

1338 bp · TkA01G578190|TK1151|CDS

ATGTCGACTGCAACATCACTCCTTAGCTCTTCACCCATCATCTTCCGGACCACCACCACCACCGCCACCACCAGCATCACCACCGTCCCACCACTGAAATTCAGACCCAAAAAACTCCGTCAATCTGCACCCAGAATGTCCATCAACAACTCTCCTCCAACCCCCACTCAACTCATCACCTCCATCACCAAACTCCTCTGGGGCAAATCCCTCCCACCACAACTCCTCATCTCCACCGTACGCTCCGCGTGGTCCACCGC...

Protein

Download Protein FASTA

445 aa · TkA01G578190|TK1151|PROTEIN

MSTATSLLSSSPIIFRTTTTTATTSITTVPPLKFRPKKLRQSAPRMSINNSPPTPTQLITSITKLLWGKSLPPQLLISTVRSAWSTAWHLMMSQLAPSDPSGSYTRPVSQFRNPNYQQLQPNSLHLYAALPCPWAHRTLIVRALKGLQDAIPVSIASPGLDGSWVFIDSPIPNGDTLILIPTRDKVNGAKTVREVYKSRRGGYDGRCTVPMLWDVEKKEVVCNESYDIIELLNSGLNSVARNPDLDLSPPELKKQIDEWN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G578190`
TK1151 ID	TkA01G578190
OH-1004 ID	LXL04_000897
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 83.371 / OH-1004 99.464 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G578190`
Location	Chr01:145379338-145381868 (+)
Description	No functional description available
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000897` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006749 glutathione metabolic process Biological Process GO:0071555 cell wall organization Biological Process GO:0098869 cellular oxidant detoxification Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component GO:0004364 glutathione transferase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0016672 oxidoreductase activity, acting on a sulfur group of donors, quinone or similar compound as acceptor Molecular Function GO:0042803 protein homodimerization activity Molecular Function GO:0045174 glutathione dehydrogenase (ascorbate) activity Molecular Function
KEGG gene cross-reference	ecj:JW3073 eco:b3102 ecoc:C3026_16935 sce:YKR076W sce:YMR251W spo:2539028 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.946

Rank 1 · TkA01G578190 · TK1151

Mitochondrion0.085

Rank 2 · TkA01G578190 · TK1151

Cytoplasm0.036

Rank 3 · TkA01G578190 · TK1151

Nucleus0.022

Rank 4 · TkA01G578190 · TK1151

Peroxisome0.021

Rank 5 · TkA01G578190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13813MBOAT_276-96 aa

PF13417GST_N_3126-150 aa

PF13409GST_N_2132-233 aa

PF13417GST_N_3205-233 aa

PF00043GST_C276-358 aa

PF13410GST_C_2280-352 aa

PF14497GST_C_3288-362 aa

PF21972Arc1p_N_like291-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G578190	`PF13813`	MBOAT_2	76	96	0.06	14.3
TkA01G578190	`PF13417`	GST_N_3	126	150	0.13	13.3
TkA01G578190	`PF13409`	GST_N_2	132	233	2.1e-10	41.7
TkA01G578190	`PF13417`	GST_N_3	205	233	0.13	13.3
TkA01G578190	`PF00043`	GST_C	276	358	4.4e-10	40.4
TkA01G578190	`PF13410`	GST_C_2	280	352	1.9e-14	54.2
TkA01G578190	`PF14497`	GST_C_3	288	362	1.5e-06	29.0
TkA01G578190	`PF21972`	Arc1p_N_like	291	324	0.3	12.1
TkA01G578190	`PF17171`	GST_C_6	293	352	0.014	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card