TkA01G576870 | RubberDandelionOmics

Gene overview

TkA01G576870

Reference: TK1151 Chr: Chr01 Coordinates: 145041281-145045686 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1402 bp · TkA01G576870|TK1151|cDNA

ACTTTTTTTTTTTTTTGGGAGCGGAACGAATCTCAAACTTGTCACCCTTTCTTTGAACCCTAACAATGGCCTTAAACCCTTGCCTCAATTTTCACTCCCTCCCCCAACTGTCCACACACACCGATACGATTCGGTACCCTGCGTCCATCACGAATATTAGGTTCATCCCCCAGCATCGAATTCTATATGCTGTTTCTAAAGATTCGGATGTAAGCTTTGAAGACGATAGAAAACCCAAAAAAACTCCGAAACCAAGAACA...

CDS

Download CDS FASTA

1017 bp · TkA01G576870|TK1151|CDS

ATGGCCTTAAACCCTTGCCTCAATTTTCACTCCCTCCCCCAACTGTCCACACACACCGATACGATTCGGTACCCTGCGTCCATCACGAATATTAGGTTCATCCCCCAGCATCGAATTCTATATGCTGTTTCTAAAGATTCGGATGTAAGCTTTGAAGACGATAGAAAACCCAAAAAAACTCCGAAACCAAGAACAAAACCGGCGTCTGAAAACACCGAAAATCGAAAAAAAGACGAAGAACCACCCTTCCCCACAACCAT...

Protein

Download Protein FASTA

338 aa · TkA01G576870|TK1151|PROTEIN

MALNPCLNFHSLPQLSTHTDTIRYPASITNIRFIPQHRILYAVSKDSDVSFEDDRKPKKTPKPRTKPASENTENRKKDEEPPFPTTIPRKPRRGRRSEVAAVEDFMRSSLEETFAAIREQNSEVLEGKDNIIREKIQDEDEEDDDTDGDADGDKKKKKKGMVVDEEDPNWPLDAEVGWGIRASEYFEKHPIKNVIGEDGVLIDWEGELDDNLVKEINCLEWESFAFHPSPLIVLVFERYNRASENWRALKELEKAAKVYW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G576870`
TK1151 ID	TkA01G576870
OH-1004 ID	LXL04_000911
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G576870

Location Chr01:145041281-145045686 (-)

Description Similar to MRL7: Thioredoxin-like fold domain-containing protein MRL7, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g28590`	Plays an essential role in early steps of chloroplast development.	Two novel proteins, MRL7 and its paralog MRL7-L, have essential but functionally distinct roles in chloroplast development and are involved in plastid gene expression regulation in Arabidopsis.2011 · DOI: 10.1093/pcp/pcr054 AtECB1/MRL7, a thioredoxin-like fold protein with disulfide reductase activity, regulates chloroplast gene expression and chloroplast biogenesis in Arabidopsis thaliana.2014 · DOI: 10.1093/mp/sst092 SVR4 (suppressor of variegation 4) and SVR4-like: two proteins with a role in proper organization of the chloroplast genetic machinery.2014 · DOI: 10.1111/ppl.12108 PRDA1, a novel chloroplast nucleoid protein, is required for early chloroplast development and is involved in the regulation of plastid gene expression in Arabidopsis.2013 · DOI: 10.1093/pcp/pct148
`At2g31840`	Plays an essential role in early steps of chloroplast development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0829000`	Plays an essential role in early steps of chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000911 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

KEGG gene cross-reference

ath:AT2G31840

ath:AT4G28590

dosa:Os01g0829000

dosa:Os05g0417200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.958

Rank 1 · TkA01G576870 · TK1151

Nucleus0.042

Rank 2 · TkA01G576870 · TK1151

Mitochondrion0.032

Rank 3 · TkA01G576870 · TK1151

Cytoplasm0.019

Rank 4 · TkA01G576870 · TK1151

Cell membrane0.014

Rank 5 · TkA01G576870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085Thioredoxin269-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G576870	`PF00085`	Thioredoxin	269	319	0.1	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JLC1`	Arabidopsis thaliana	sp\|F4JLC1\|MRL7_ARATH Thioredoxin-like fold domain-containing protein MRL7, chloroplastic	62.200%	Swiss-Prot	High
`Q9SKB6`	Arabidopsis thaliana	sp\|Q9SKB6\|MRL7L_ARATH Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic	45.400%	Swiss-Prot	Low
`Q5QLS7`	Oryza sativa subsp. japonica	sp\|Q5QLS7\|MRL7_ORYSJ Thioredoxin-like fold domain-containing protein MRL7 homolog, chloroplastic	66.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card