TkA01G562430 | RubberDandelionOmics

Gene overview

TkA01G562430

Reference: TK1151 Chr: Chr01 Coordinates: 141399059-141411638 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1241 bp · TkA01G562430|TK1151|cDNA

AAAGTATTACAACAGACGCCGAAATAAACCCTTGACGCTTCTACAGTACTGAGTGATCGATCCCATCTGTACTAAAACCCACCAAAACCCCCTCTTCACCTCTGCAACACTCATTTCTCCGTCTTCGTATTCATCTACGTCCGACAATGGCGTCTGTGGCTTTCAGAAACCCTAACTCTAGGCGTTTGATTAAACTATCCCCTCAATTACGTTCTGGTTGTCGAGGATCCGTAGTATCAGCTTCTGGTTTCCCAACCGTT...

CDS

Download CDS FASTA

1356 bp · TkA01G562430|TK1151|CDS

ATGGCGTCTGTGGCTTTCAGAAACCCTAACTCTAGGCGTTTGATTAAACTATCCCCTCAATTACGTTCTGGTTGTCGAGGATCCGTAGTATCAGCTTCTGGTTTCCCAACCGTTGAATCGCTTTCTGGAAATGACAACACGGTGGCTCCTAATCCGTGGTGGAGATCCATGGCCACTTTCACCCGAACAAAACCTCATGTTAATGTTGGAACAATTGGACATGTTGATCATGGAAAGACAACACTGACTGCTGCAATTAC...

Protein

Download Protein FASTA

451 aa · TkA01G562430|TK1151|PROTEIN

MASVAFRNPNSRRLIKLSPQLRSGCRGSVVSASGFPTVESLSGNDNTVAPNPWWRSMATFTRTKPHVNVGTIGHVDHGKTTLTAAITKVLADEGKAKAIAFDEIDKAPEEKKRGITIATAHVEYETAKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAPDGPMPQTKEHILLARQVGVPSLVCFLNKVDAVDDPELLELVELELRELLSFYKFPGDEIPIVRGSALSALQGNNDEIGKQAILKLMEAVDNYIPTPE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G562430`
TK1151 ID	TkA01G562430
OH-1004 ID	LXL04_001079
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G562430

Location Chr01:141399059-141411638 (-)

Description Similar to TUFA: Elongation factor Tu, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02930`	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001079 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046686 response to cadmium ion Biological Process

GO:0070125 mitochondrial translational elongation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0003746 translation elongation factor activity Molecular Function

GO:0003924 GTPase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0005525 GTP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

afw:Anae109_1910

afw:Anae109_2229

ath:AT4G02930

gbe:GbCGDNIH1_0552

swi:Swit_1355

zmo:ZMO0516

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.915

Rank 1 · TkA01G562430 · TK1151

Cytoplasm0.073

Rank 2 · TkA01G562430 · TK1151

Plastid0.062

Rank 3 · TkA01G562430 · TK1151

Nucleus0.048

Rank 4 · TkA01G562430 · TK1151

Cell membrane0.030

Rank 5 · TkA01G562430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00009GTP_EFTU64-258 aa

PF01926MMR_HSR169-186 aa

PF00410Ribosomal_S878-170 aa

PF21875CAPN13-like_C_EFh179-194 aa

PF22042EF-G_D2278-318 aa

PF03143GTP_EFTU_D3279-289 aa

PF03144GTP_EFTU_D2281-351 aa

PF03143GTP_EFTU_D3355-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G562430	`PF00009`	GTP_EFTU	64	258	2.8e-62	210.4
TkA01G562430	`PF01926`	MMR_HSR1	69	186	0.0018	19.1
TkA01G562430	`PF00410`	Ribosomal_S8	78	170	0.016	15.9
TkA01G562430	`PF21875`	CAPN13-like_C_EFh	179	194	0.27	11.9
TkA01G562430	`PF22042`	EF-G_D2	278	318	0.0057	17.4
TkA01G562430	`PF03143`	GTP_EFTU_D3	279	289	1.1e-37	129.3
TkA01G562430	`PF03144`	GTP_EFTU_D2	281	351	1.5e-21	77.3
TkA01G562430	`PF03143`	GTP_EFTU_D3	355	449	1.1e-37	129.3
TkA01G562430	`PF21875`	CAPN13-like_C_EFh	390	409	0.27	11.9
TkA01G562430	`PF22594`	GTP-eEF1A_C	395	446	0.02	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT91`	Arabidopsis thaliana	sp\|Q9ZT91\|EFTM_ARATH Elongation factor Tu, mitochondrial	82.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card