TkA01G556380 | RubberDandelionOmics

Gene overview

TkA01G556380

Reference: TK1151 Chr: Chr01 Coordinates: 139867673-139869902 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1891 bp · TkA01G556380|TK1151|cDNA

TAAGTAATGGTCATTAGTGACATAAGAATTTCCAAAATAAATATCTTATGGTACGATTTAATAAATTAAGTTTCTCATTGACATATATAAAGCCGCGCACCAGCGTGTTTATGCATGTATTCCTTTCATATTCTATACGCCTCCAGACTTTGAATCAAACAGTTCATAATTAAAATTGCTTGGAGTTTGTGCAAGTGCCTTCCAACTGTTCGAAGAAAGGAGTAGCTCAAATCCGTCATAATAGTCTCGTTCTCAAAAAA...

CDS

Download CDS FASTA

1257 bp · TkA01G556380|TK1151|CDS

ATGGATCGTTACGAGTTAGGGAAATTATTAGGGCAGGGGAATTTCGCAAAAGTCTACCATGGAAGAAACCTCGAGACAGGGGAAAGCGTTGCAGTTAAGGTCATAAATAAAGAGAAGATTATGAAAGTAGGGTTAATGAATCAAATCAAGAGAGAGATCTCAGTGATGAGATTCGTCAAGCACCCAAATGTAGTCCAACTCCACGAAGTCATGGCTAGCAAAACCAAAATTTACTTCGTTTTAGAATACTTAAAAGGAGG...

Protein

Download Protein FASTA

418 aa · TkA01G556380|TK1151|PROTEIN

MDRYELGKLLGQGNFAKVYHGRNLETGESVAVKVINKEKIMKVGLMNQIKREISVMRFVKHPNVVQLHEVMASKTKIYFVLEYLKGGELYNKLTKGKLKEATARKYFQQLITAVNFCHTQGVYHRDLKPENLLLDDDGNLKVSDFGLSALVETKWEDGLLHTSCGTPAYVAPEVIHRKGYDGRKSDIWSCGVILFVLLAGFLPFQDSNLMEMYRKITKAKFKFPNWFPFEARKLVSKILDPNPKTRISIAKIMENSWFKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G556380`
TK1151 ID	TkA01G556380
OH-1004 ID	LXL04_001183
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	67.600
Protein coverage (%)	TK1151 100.000 / OH-1004 98.077 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G556380

Location Chr01:139867673-139869902 (+)

Description Similar to CIPK2: CBL-interacting protein kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58380`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0678600`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os05g0332300`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os03g0339900`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os01g0206700`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001183 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G45820

dosa:Os01g0206700

dosa:Os03g0339900

dosa:Os05g0332300

dosa:Os07g0678600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · TkA01G556380 · TK1151

Nucleus0.456

Rank 2 · TkA01G556380 · TK1151

Cell membrane0.123

Rank 3 · TkA01G556380 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA01G556380 · TK1151

Lysosome / Vacuole0.041

Rank 5 · TkA01G556380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase4-258 aa

PF07714PK_Tyr_Ser-Thr5-254 aa

PF03109ABC114-59 aa

PF01636APH47-113 aa

PF01163RIO147-77 aa

PF03109ABC174-159 aa

PF01163RIO179-146 aa

PF14531Kinase-like88-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G556380	`PF00069`	Pkinase	4	258	1.9e-76	257.6
TkA01G556380	`PF07714`	PK_Tyr_Ser-Thr	5	254	5e-42	144.7
TkA01G556380	`PF03109`	ABC1	14	59	2.7e-08	34.0
TkA01G556380	`PF01636`	APH	47	113	0.013	16.0
TkA01G556380	`PF01163`	RIO1	47	77	0.059	13.7
TkA01G556380	`PF03109`	ABC1	74	159	2.7e-08	34.0
TkA01G556380	`PF01163`	RIO1	79	146	0.059	13.7
TkA01G556380	`PF14531`	Kinase-like	88	244	2e-07	31.3
TkA01G556380	`PF06293`	Kdo	90	140	0.032	14.4
TkA01G556380	`PF01636`	APH	120	140	0.013	16.0
TkA01G556380	`PF03822`	NAF	296	355	7.1e-20	71.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C562`	Arabidopsis thaliana	sp\|Q9C562\|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10	57.500%	Swiss-Prot	High
`Q7X996`	Oryza sativa subsp. japonica	sp\|Q7X996\|CIPK2_ORYSJ CBL-interacting protein kinase 2	62.100%	Swiss-Prot	High
`Q5W736`	Oryza sativa subsp. japonica	sp\|Q5W736\|CIPKI_ORYSJ CBL-interacting protein kinase 18	61.800%	Swiss-Prot	High
`Q10LQ2`	Oryza sativa subsp. japonica	sp\|Q10LQ2\|CIPKA_ORYSJ CBL-interacting protein kinase 10	59.500%	Swiss-Prot	High
`Q9LWM4`	Oryza sativa subsp. japonica	sp\|Q9LWM4\|CIPK5_ORYSJ CBL-interacting protein kinase 5	57.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card