LXL04_001183 | RubberDandelionOmics

Gene overview

LXL04_001183

Reference: OH-1004 Chr: Chr01 Coordinates: 21615455-21616705 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · LXL04_001183|LXL04_001183|OH1004|cDNA

ATGGACAGTAAAGACGGTGTATTGATGCAACGTTACGAGTTAGGGAAGATGGTCGGCCATGGGAATTTCGCAAAAGTTTTCCATGGCAGACACCTTAAAACAGGGATGAATGTTGCAGTTAAAATCATCAACAAATCGAAGGTTATGAAAGCCGGGATGGTGAATCAAATAAAAAGAGAGATCTCGGTGATGAAATTAGTCAAACACCCGCACATAGTACACCTCCACGAAGTCATGGCTAGCAAATCCAAGATTTACTT...

CDS

Download CDS FASTA

1251 bp · LXL04_001183|LXL04_001183|OH1004|CDS

ATGGACAGTAAAGACGGTGTATTGATGCAACGTTACGAGTTAGGGAAGATGGTCGGCCATGGGAATTTCGCAAAAGTTTTCCATGGCAGACACCTTAAAACAGGGATGAATGTTGCAGTTAAAATCATCAACAAATCGAAGGTTATGAAAGCCGGGATGGTGAATCAAATAAAAAGAGAGATCTCGGTGATGAAATTAGTCAAACACCCGCACATAGTACACCTCCACGAAGTCATGGCTAGCAAATCCAAGATTTACTT...

Protein

Download Protein FASTA

416 aa · LXL04_001183|LXL04_001183|OH1004|PROTEIN

MDSKDGVLMQRYELGKMVGHGNFAKVFHGRHLKTGMNVAVKIINKSKVMKAGMVNQIKREISVMKLVKHPHIVHLHEVMASKSKIYFVLEYVKGGELFDKLLKGKLKEDSARKYFRQLISAISFCHSRGVYHRDLKPENLLLDDEGNLKVSDFGLSALAETRRQDGLLHTSCGTPTYVAPEVIDQKGYDGAKSDIWSCGVVLFVLLAGFLPFHDSNLMEMYRKITMGKFKFPNSFPNEAKSLVSRILDPNPVTRISIAEI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001183`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001183

Location Chr01:21615455-21616705 (+)

Description Similar to CIPK2: CBL-interacting protein kinase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45820`	CIPK serine-threonine protein kinases interact with CBL proteins.	Constitutive activation and transgenic evaluation of the function of an arabidopsis PKS protein kinase.2002 · DOI: 10.1074/jbc.m205504200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0678600`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os01g0206700`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os05g0332300`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os03g0339900`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001183 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G45820

dosa:Os01g0206700

dosa:Os03g0339900

dosa:Os05g0332300

dosa:Os07g0678600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.513

Rank 1 · LXL04_001183 · OH-1004

Nucleus0.469

Rank 2 · LXL04_001183 · OH-1004

Cell membrane0.124

Rank 3 · LXL04_001183 · OH-1004

Endoplasmic reticulum0.048

Rank 4 · LXL04_001183 · OH-1004

Lysosome / Vacuole0.042

Rank 5 · LXL04_001183 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase12-266 aa

PF07714.24PK_Tyr_Ser-Thr13-262 aa

PF03109.23ABC183-167 aa

PF14531.13Kinase-like108-250 aa

PF03822.21NAF296-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001183	`PF00069.32`	Pkinase	12	266	1.1e-76	258.5
LXL04_001183	`PF07714.24`	PK_Tyr_Ser-Thr	13	262	2.5e-42	145.7
LXL04_001183	`PF03109.23`	ABC1	83	167	1.1e-06	28.7
LXL04_001183	`PF14531.13`	Kinase-like	108	250	1.3e-06	28.6
LXL04_001183	`PF03822.21`	NAF	296	353	4.6e-18	65.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJ54`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 20	57.277%	Swiss-Prot	strong database homology
`Q7X996`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 2	56.674%	Swiss-Prot	strong database homology
`Q9LWM4`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 5	53.687%	Swiss-Prot	strong database homology
`Q5W736`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 18	57.773%	Swiss-Prot	strong database homology
`Q10LQ2`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 10	54.566%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card