TkA01G551620 | RubberDandelionOmics

Gene overview

TkA01G551620

Reference: TK1151 Chr: Chr01 Coordinates: 138654924-138657625 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1316 bp · TkA01G551620|TK1151|cDNA

GTGGGCAATGAGTCATCTGGTTGTATCGCATTTGACTCCATCCATCATCGTTTATCACTTCAGCATCACCAACAGTCAAATACGATTTGCATTTGCTTATATTTGTTTATCGGCGCTTTCATCGAAGCTTGTTCTTGTTTCGCTGTATACTCAGAAACTATGGCGGAAGCGAAGATTGCAATCGCTAAGGATGTTACAGAATTGATCGGTAACACACCTTTGGTTTATCTCAACAATGTTGTGGATGGTTGCGTTGGGCG...

CDS

Download CDS FASTA

1137 bp · TkA01G551620|TK1151|CDS

GTGGGCAATGAGTCATCTGGTTGTATCGCATTTGACTCCATCCATCATCGTTTATCACTTCAGCATCACCAACAGTCAAATACGATTTGCATTTGCTTATATTTGTTTATCGGCGCTTTCATCGAAGCTTGTTCTTGTTTCGCTGTATACTCAGAAACTATGGCGGAAGCGAAGATTGCAATCGCTAAGGATGTTACAGAATTGATCGGTAACACACCTTTGGTTTATCTCAACAATGTTGTGGATGGTTGCGTTGGGCG...

Protein

Download Protein FASTA

378 aa · TkA01G551620|TK1151|PROTEIN

VGNESSGCIAFDSIHHRLSLQHHQQSNTICICLYLFIGAFIEACSCFAVYSETMAEAKIAIAKDVTELIGNTPLVYLNNVVDGCVGRIAAKLEMMEPCSSVKDRIGYSMISDAEAKGLITPGQSVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILRAFGAELVLTDPAKGMKGAVQKAEEILAKTPNAYLLQQFENPANPKIHYETTGPEIWKGSGGKIDAFVSGIGTGGTITGAGKYLKEQNPNIKLIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G551620`
TK1151 ID	TkA01G551620
OH-1004 ID	LXL04_008856
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.700
Protein coverage (%)	TK1151 84.392 / OH-1004 99.068 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G551620

Location Chr01:138654924-138657625 (+)

Description Similar to Cysteine synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14880`	Acts as a major cysteine synthase, probably involved in maintaining organic sulfur level.	A mutation in the cytosolic O-acetylserine (thiol) lyase induces a genome-dependent early leaf death phenotype in Arabidopsis.2010 · DOI: 10.1186/1471-2229-10-80

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008856 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006535 L-cysteine biosynthetic process from L-serine Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009836 fruit ripening, climacteric Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0004124 cysteine synthase activity Molecular Function

GO:0047458 beta-pyrazolylalanine synthase activity Molecular Function

GO:0050017 L-3-cyanoalanine synthase activity Molecular Function

GO:0050234 pyrazolylalanine synthase activity Molecular Function

GO:0050461 L-mimosine synthase activity Molecular Function

KEGG gene cross-reference

ag:BAA05965

zma:542438

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.536

Rank 1 · TkA01G551620 · TK1151

Nucleus0.209

Rank 2 · TkA01G551620 · TK1151

Peroxisome0.130

Rank 3 · TkA01G551620 · TK1151

Mitochondrion0.120

Rank 4 · TkA01G551620 · TK1151

Plastid0.104

Rank 5 · TkA01G551620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00291PALP65-352 aa

PF19180DUF5862227-249 aa

PF19180DUF5862319-334 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G551620	`PF00291`	PALP	65	352	1.1e-76	258.7
TkA01G551620	`PF19180`	DUF5862	227	249	2.7	8.7
TkA01G551620	`PF19180`	DUF5862	319	334	2.7	8.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P47998`	Arabidopsis thaliana	sp\|P47998\|CYSK1_ARATH Cysteine synthase 1	87.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card