RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G535530
Reference: TK1151 Chr: Chr01 Coordinates: 134397273-134397751 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

372 bp · TkA01G535530|TK1151|cDNA

TCTAGATCCGCCAACAACGAATTATTTAGTCCAGAACATGATGAAGAAGGAGGATGGGGCACCAAAATTAAGGAGTATGATCAGTCCGGTGTCGTGCAGAAAAGGGGGAGTCTAGCCTACTTGACGTGGGAGGAGCTTGGAGTAGCTTCGTTAGGGAAAGATGGAGGTAAATCCTTGCTTACTGGTGTCTCTGGTTATGCTAAACCGGGAGAGATGGTGACCATTATGGGTCCTTCTGGGTGTGGAAAATCCACGCTCCT...

CDS

Download CDS FASTA

372 bp · TkA01G535530|TK1151|CDS

TCTAGATCCGCCAACAACGAATTATTTAGTCCAGAACATGATGAAGAAGGAGGATGGGGCACCAAAATTAAGGAGTATGATCAGTCCGGTGTCGTGCAGAAAAGGGGGAGTCTAGCCTACTTGACGTGGGAGGAGCTTGGAGTAGCTTCGTTAGGGAAAGATGGAGGTAAATCCTTGCTTACTGGTGTCTCTGGTTATGCTAAACCGGGAGAGATGGTGACCATTATGGGTCCTTCTGGGTGTGGAAAATCCACGCTCCT...

Protein

Download Protein FASTA

123 aa · TkA01G535530|TK1151|PROTEIN

SRSANNELFSPEHDEEGGWGTKIKEYDQSGVVQKRGSLAYLTWEELGVASLGKDGGKSLLTGVSGYAKPGEMVTIMGPSGCGKSTLLDSLAGWLASNTRHTGRVLINGRKQRLTYGTLVWKQY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G535530
TK1151 IDTkA01G535530
OH-1004 IDLXL04_001435
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)94.100
Protein coverage (%)TK1151 95.935 / OH-1004 57.949
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G535530
LocationChr01:134397273-134397751 (+)
DescriptionSimilar to ABCG12: ABC transporter G family member 12
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g55100 ABC transporter G family member 17. No verified direct reference in this release
At5g13580 ABC transporter G family member 6. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8ALI0 Essential transporter for growth and development under abiotic stress. No verified direct reference in this release
Os03g0281900 Essential transporter for growth and development under abiotic stress.
Rice shoot branching requires an ATP-binding cassette subfamily G protein.2009 · DOI: 10.1111/j.1469-8137.2008.02724.x
Genome-wide analysis and expression profiling of half-size ABC protein subgroup G in rice in response to abiotic stress and phytohormone treatments.2012 · DOI: 10.1007/s00438-012-0719-3
Rice RCN1/OsABCG5 mutation alters accumulation of essential and nonessential minerals and causes a high Na/K ratio, resulting in a salt-sensitive phenotype.2014 · DOI: 10.1016/j.plantsci.2014.04.011
RCN1/OsABCG5, an ATP-binding cassette (ABC) transporter, is required for hypodermal suberization of roots in rice (Oryza sativa).2014 · DOI: 10.1111/tpj.12614
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001435 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006869 lipid transport Biological Process
GO:0009611 response to wounding Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010025 wax biosynthetic process Biological Process
GO:0010222 stem vascular tissue pattern formation Biological Process
GO:0010345 suberin biosynthetic process Biological Process
GO:0010588 cotyledon vascular tissue pattern formation Biological Process
GO:0010597 green leaf volatile biosynthetic process Biological Process
GO:0015908 fatty acid transport Biological Process
GO:0051607 defense response to virus Biological Process
GO:0055085 transmembrane transport Biological Process
KEGG gene cross-reference
ath:AT1G17840
ath:AT1G51460
ath:AT1G51500
ath:AT3G21090
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.442
Rank 1 · TkA01G535530 · TK1151
Cytoplasm0.166
Rank 2 · TkA01G535530 · TK1151
Nucleus0.135
Rank 3 · TkA01G535530 · TK1151
Plastid0.127
Rank 4 · TkA01G535530 · TK1151
Endoplasmic reticulum0.097
Rank 5 · TkA01G535530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00485PRK8-35 aa
PF13555AAA_2953-65 aa
PF03308MeaB56-98 aa
PF00005ABC_tran60-110 aa
PF09818ABC_ATPase63-106 aa
PF13481AAA_2564-95 aa
PF00437T2SSE67-100 aa
PF14516AAA_3567-92 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G535530PF00485PRK8350.1712.4
TkA01G535530PF13555AAA_2953651.2e-0525.7
TkA01G535530PF03308MeaB56980.2311.2
TkA01G535530PF00005ABC_tran601101.6e-0939.2
TkA01G535530PF09818ABC_ATPase631060.4510.2
TkA01G535530PF13481AAA_2564950.005317.1
TkA01G535530PF00437T2SSE671000.0214.2
TkA01G535530PF14516AAA_3567920.2810.7
TkA01G535530PF13191AAA_16681020.001519.8
TkA01G535530PF03215Rad1769970.002718.4
TkA01G535530PF25199nSTAND_NTPase5691100.004317.6
TkA01G535530PF01637ATPase_269910.03914.5
TkA01G535530PF03193RsgA_GTPase701090.0001322.5
TkA01G535530PF00931NB-ARC70890.05813.7
TkA01G535530PF13245AAA_19701000.2512.2
TkA01G535530PF00006ATP-synt_ab70940.3911.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9M2V6Arabidopsis thalianasp|Q9M2V6|AB17G_ARATH ABC transporter G family member 1751.900%Swiss-ProtLow
Q9FNB5Arabidopsis thalianasp|Q9FNB5|AB6G_ARATH ABC transporter G family member 646.200%Swiss-ProtLow
B8ALI0Oryza sativa subsp. indicasp|B8ALI0|AB5G_ORYSI ABC transporter G family member 550.000%Swiss-ProtLow
Q8H8V7Oryza sativa subsp. japonicasp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 550.000%Swiss-ProtLow

JBrowse

View in Genome Browser