TkA01G526390 | RubberDandelionOmics

Gene overview

TkA01G526390

Reference: TK1151 Chr: Chr01 Coordinates: 132138780-132141062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1754 bp · TkA01G526390|TK1151|cDNA

ATCACCCGTCCTCGTCATCGTCATCGTCTTCTCCCTTTCACACGCTATTTCTCCCACTTTTTTATACTTTTCCACCCCATAACTCCTTCCCCTTCTCCCTCTCCCCATCTCTCCACCAATATTCCGACAACAAAAACCTCAATCAAGTCTCCCATTCACCTTCCAGTTTGCAATCCAAACGCGTATTCACCGGATTTCAGTTCATCGAAGATGTTGCGGATGTGTGTTAAGCCATTGGAAAGATGTTTAGGACGCCGGAG...

CDS

Download CDS FASTA

1332 bp · TkA01G526390|TK1151|CDS

ATCACCCGTCCTCGTCATCGTCATCGTCTTCTCCCTTTCACACGCTATTTCTCCCACTTTTTTATACTTTTCCACCCCATAACTCCTTCCCCTTCTCCCTCTCCCCATCTCTCCACCAATATTCCGACAACAAAAACCTCAATCAAGTCTCCCATTCACCTTCCAGTTTGCAATCCAAACGCGTATTCACCGGATTTCAGTTCATCGAAGATGTTGCGGATGTGTGTTAAGCCATTGGAAAGATGTTTAGGACGCCGGAG...

Protein

Download Protein FASTA

443 aa · TkA01G526390|TK1151|PROTEIN

ITRPRHRHRLLPFTRYFSHFFILFHPITPSPSPSPHLSTNIPTTKTSIKSPIHLPVCNPNAYSPDFSSSKMLRMCVKPLERCLGRRSGDVLLWHNDLKPHASGDFSIAVVQANSNLEDQSQVYTSPSATYVGVYDGHGGPEASRFVNSNLFPFIHKYASEQGGISADVIKKAFNATEEKFFQFVKHQMPIRPQIASVGSCCLVGAISNDELHVANLGDSRVVLGQKVSDGRKDKVIAERLSRDHNVSYEEVRKEVEAQHP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G526390`
TK1151 ID	TkA01G526390
OH-1004 ID	LXL04_013600
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.000
Protein coverage (%)	TK1151 81.490 / OH-1004 97.878 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G526390

Location Chr01:132138780-132141062 (+)

Description Similar to At4g33920: Probable protein phosphatase 2C 63

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33920`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0580900`	Probable protein phosphatase 2C 78.	No verified direct reference in this release
`UniProt: Q5MFV5`	Probable protein phosphatase 2C 34.	No verified direct reference in this release
`Os03g0761100`	Probable protein phosphatase 2C 34.	No verified direct reference in this release
`Os03g0207400`	Probable protein phosphatase 2C 29.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013600 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0004741 [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G33920

dosa:Os03g0207400

dosa:Os03g0761100

dosa:Os12g0580900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.307

Rank 1 · TkA01G526390 · TK1151

Cytoplasm0.283

Rank 2 · TkA01G526390 · TK1151

Cell membrane0.207

Rank 3 · TkA01G526390 · TK1151

Endoplasmic reticulum0.108

Rank 4 · TkA01G526390 · TK1151

Mitochondrion0.089

Rank 5 · TkA01G526390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27638PABIR_N19-34 aa

PF13672PP2C_2111-228 aa

PF00481PP2C124-376 aa

PF13298LigD_N227-277 aa

PF27638PABIR_N273-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G526390	`PF27638`	PABIR_N	19	34	0.72	11.4
TkA01G526390	`PF13672`	PP2C_2	111	228	0.0057	17.0
TkA01G526390	`PF00481`	PP2C	124	376	1e-40	140.7
TkA01G526390	`PF13298`	LigD_N	227	277	0.1	13.5
TkA01G526390	`PF27638`	PABIR_N	273	320	0.72	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81760`	Arabidopsis thaliana	sp\|O81760\|P2C63_ARATH Probable protein phosphatase 2C 63	67.600%	Swiss-Prot	High
`Q2QN36`	Oryza sativa subsp. japonica	sp\|Q2QN36\|P2C78_ORYSJ Probable protein phosphatase 2C 78	63.400%	Swiss-Prot	High
`Q5MFV5`	Oryza sativa subsp. indica	sp\|Q5MFV5\|P2C34_ORYSI Probable protein phosphatase 2C 34	54.700%	Swiss-Prot	High
`Q94H98`	Oryza sativa subsp. japonica	sp\|Q94H98\|P2C34_ORYSJ Probable protein phosphatase 2C 34	54.700%	Swiss-Prot	High
`Q8H063`	Oryza sativa subsp. japonica	sp\|Q8H063\|P2C29_ORYSJ Probable protein phosphatase 2C 29	55.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card