LXL04_013600 | RubberDandelionOmics

Gene overview

LXL04_013600

Reference: OH-1004 Chr: Chr03 Coordinates: 32271479-32273087 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1134 bp · LXL04_013600|LXL04_013600|OH1004|cDNA

ATGTTAGAGTCGTGTTACAGGCCACTGGAGCGGTGttttggtggtggtggtggcgacGGACTTTTATGGAACATGGACTTGAAACCACATGCGTCCGGTGAATACTCCGTTGCTGTTGTTCAGGCGAATTCAATGCTCGAAGACCAAGGTCAAGTGTTAACTTCACCGTCTGCGACCTATATCGGAGTTTACGATGGCCACGGTGGCCCCGAAGCCTCTAGATTCATCAACAGTCACCTCTTTCGTTACCTCGAGAAATT...

CDS

Download CDS FASTA

1134 bp · LXL04_013600|LXL04_013600|OH1004|CDS

ATGTTAGAGTCGTGTTACAGGCCACTGGAGCGGTGTTTTGGTGGTGGTGGTGGCGACGGACTTTTATGGAACATGGACTTGAAACCACATGCGTCCGGTGAATACTCCGTTGCTGTTGTTCAGGCGAATTCAATGCTCGAAGACCAAGGTCAAGTGTTAACTTCACCGTCTGCGACCTATATCGGAGTTTACGATGGCCACGGTGGCCCCGAAGCCTCTAGATTCATCAACAGTCACCTCTTTCGTTACCTCGAGAAATT...

Protein

Download Protein FASTA

377 aa · LXL04_013600|LXL04_013600|OH1004|PROTEIN

MLESCYRPLERCFGGGGGDGLLWNMDLKPHASGEYSVAVVQANSMLEDQGQVLTSPSATYIGVYDGHGGPEASRFINSHLFRYLEKFAAERGGLSKDVIAKAFDATETDFLHLVKESWLDRPQIVSVGSCCLVGVISNGTLFVANLGDSRAVLGRQASNGGRMTNSSTVVAERLSTDHNVGVEEVRKEVKALHPDDSHIVVYTHGVWRIKGIIQVSRSIGDVYLKKPEYNRNPLFQQYASPFPLKRAVMSAEPSIITRKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013600`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013600

Location Chr03:32271479-32273087 (-)

Description Similar to At4g33920: Probable protein phosphatase 2C 63

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g33920`	May dephosphorylate and repress plasma membrane H(+)-ATPases (PM H(+)-ATPases, e.g. AHA1 and AHA2), thus influencing negatively plant growth and fitness.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0580900`	Probable protein phosphatase 2C 78.	No verified direct reference in this release
`Os03g0207400`	Probable protein phosphatase 2C 29.	No verified direct reference in this release
`Os03g0761100`	Probable protein phosphatase 2C 34.	No verified direct reference in this release
`UniProt: Q5MFV5`	Probable protein phosphatase 2C 34.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013600 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0004741 [pyruvate dehydrogenase (acetyl-transferring)]-phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT4G33920

dosa:Os03g0207400

dosa:Os03g0761100

dosa:Os12g0580900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.343

Rank 1 · LXL04_013600 · OH-1004

Nucleus0.335

Rank 2 · LXL04_013600 · OH-1004

Cell membrane0.295

Rank 3 · LXL04_013600 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_013600 · OH-1004

Lysosome / Vacuole0.076

Rank 5 · LXL04_013600 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C55-309 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013600	`PF00481.27`	PP2C	55	309	2.4e-38	133.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81760`	Arabidopsis thaliana	Probable protein phosphatase 2C 63	67.925%	Swiss-Prot	strong database homology
`Q2QN36`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 78	65.608%	Swiss-Prot	strong database homology
`Q8H063`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 29	62.849%	Swiss-Prot	strong database homology
`Q94H98`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 34	56.989%	Swiss-Prot	strong database homology
`Q5MFV5`	Oryza sativa subsp. indica	Probable protein phosphatase 2C 34	56.989%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card