TkA01G521110 | RubberDandelionOmics

Gene overview

TkA01G521110

Reference: TK1151 Chr: Chr01 Coordinates: 130675596-130677214 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1174 bp · TkA01G521110|TK1151|cDNA

AAAATAACAAACTCCGTAAGTTTCCACCGTCCGATTTATATATATGGAATCGCCCGTTAATTCTCTCTCCTCAACGATCAACTCTCAGTATCTCTAGTGAGAGAACCTGATCAGATTTCAGTGATGGACGATTCAAAATTACGTAGCGGCGTGCGGCGGAGCAGAGAGACGGAGGCTATAAGCTCCGGCTCTGGTAAGAAAAGAAGATTCGAACCTCGAGATCAAGAGAATGGTGTTCAGCTGGAAAATCAGTGCCAAAG...

CDS

Download CDS FASTA

567 bp · TkA01G521110|TK1151|CDS

ATGGACGATTCAAAATTACGTAGCGGCGTGCGGCGGAGCAGAGAGACGGAGGCTATAAGCTCCGGCTCTGGTAAGAAAAGAAGATTCGAACCTCGAGATCAAGAGAATGGTGTTCAGCTGGAAAATCAGTGCCAAAGTGGAGTTGACGTGAATTTCCCGGAGGATGTTATTTCTTCAGCGGACTCCGATTGTTGTGATCATGATTTGTCGTCTCAATTCTTGAAGGATGATTTAAGCTTAGATCTGAAGGCGGAGCTTCG...

Protein

Download Protein FASTA

188 aa · TkA01G521110|TK1151|PROTEIN

MDDSKLRSGVRRSRETEAISSGSGKKRRFEPRDQENGVQLENQCQSGVDVNFPEDVISSADSDCCDHDLSSQFLKDDLSLDLKAELRFVTETSMSSNDGFSRETSSSSEICVDSEAMESPKQPASPQPAATSRRKPIKVSNLPTAAEIDEFFSVAEKKEQKRFADKYNFDFVNDAPMEGRYQWVRLKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G521110`
TK1151 ID	TkA01G521110
OH-1004 ID	LXL04_001634
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G521110

Location Chr01:130675596-130677214 (+)

Description Similar to KRP7: Cyclin-dependent kinase inhibitor 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49620`	Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity.	Arabidopsis KRPs have distinct inhibitory activity toward cyclin D2-associated kinases, including plant-specific B-type cyclin-dependent kinase.2006 · DOI: 10.1016/j.febslet.2005.12.018
`At3g19150`	Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity.	Cyclin D1 and p22ack1 play opposite roles in plant growth and development.2004 · DOI: 10.1016/j.bbrc.2004.08.233 Overexpression of Arabidopsis ACK1 alters leaf morphology and retards growth and development.2005 · DOI: 10.1016/j.bbrc.2005.03.056 Targeted degradation of the cyclin-dependent kinase inhibitor ICK4/KRP6 by RING-type E3 ligases is essential for mitotic cell cycle progression during Arabidopsis gametogenesis.2008 · DOI: 10.1105/tpc.108.059741

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0471700`	Cyclin-dependent kinase inhibitor 4.	No verified direct reference in this release
`Os09g0459900`	Cyclin-dependent kinase inhibitor 6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001634 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045740 positive regulation of DNA replication Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0001673 male germ cell nucleus Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity Molecular Function

GO:0019900 kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G49620

ath:AT3G19150

ath:AT5G48820

dosa:Os09g0459900

dosa:Os10g0471700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · TkA01G521110 · TK1151

Cytoplasm0.192

Rank 2 · TkA01G521110 · TK1151

Cell membrane0.024

Rank 3 · TkA01G521110 · TK1151

Mitochondrion0.021

Rank 4 · TkA01G521110 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA01G521110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02234CDI76-85 aa

PF14566PTPlike_phytase93-160 aa

PF02234CDI143-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G521110	`PF02234`	CDI	76	85	1.6e-18	67.2
TkA01G521110	`PF14566`	PTPlike_phytase	93	160	0.25	12.1
TkA01G521110	`PF02234`	CDI	143	186	1.6e-18	67.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CL9`	Arabidopsis thaliana	sp\|Q94CL9\|KRP7_ARATH Cyclin-dependent kinase inhibitor 7	40.700%	Swiss-Prot	Medium
`Q0WNX9`	Arabidopsis thaliana	sp\|Q0WNX9\|KRP6_ARATH Cyclin-dependent kinase inhibitor 6	37.900%	Swiss-Prot	Medium
`Q7XDH8`	Oryza sativa subsp. japonica	sp\|Q7XDH8\|KRP4_ORYSJ Cyclin-dependent kinase inhibitor 4	39.100%	Swiss-Prot	Low
`Q67J15`	Oryza sativa subsp. japonica	sp\|Q67J15\|KRP6_ORYSJ Cyclin-dependent kinase inhibitor 6	49.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card