LXL04_001634 | RubberDandelionOmics

Gene overview

LXL04_001634

Reference: OH-1004 Chr: Chr01 Coordinates: 30440311-30441326 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

567 bp · LXL04_001634|LXL04_001634|OH1004|cDNA

ATGGACGATTCAAAATTACGTGGCGGCGTGCGGCGGAGCAGAGAGACGGAGGCTGTAAGCTCCGGCTCCGGTAAGAGAAGAAGATTCGATCCTCGAGATCAAGAGAATGGTGTTCATCTGGAAAATCAGTGCCAAAGTGGAGTTGACGTGGATTTCCCGGAGGATGTTATTTCTTCAGCGGACTCCGATTGTTGTGATCATGTTTTGTCGTCTCAATTCTTGAAGGATGATTTGCGCTTAGATCTGAAGGCGGAGCTTCG...

CDS

Download CDS FASTA

567 bp · LXL04_001634|LXL04_001634|OH1004|CDS

ATGGACGATTCAAAATTACGTGGCGGCGTGCGGCGGAGCAGAGAGACGGAGGCTGTAAGCTCCGGCTCCGGTAAGAGAAGAAGATTCGATCCTCGAGATCAAGAGAATGGTGTTCATCTGGAAAATCAGTGCCAAAGTGGAGTTGACGTGGATTTCCCGGAGGATGTTATTTCTTCAGCGGACTCCGATTGTTGTGATCATGTTTTGTCGTCTCAATTCTTGAAGGATGATTTGCGCTTAGATCTGAAGGCGGAGCTTCG...

Protein

Download Protein FASTA

188 aa · LXL04_001634|LXL04_001634|OH1004|PROTEIN

MDDSKLRGGVRRSRETEAVSSGSGKRRRFDPRDQENGVHLENQCQSGVDVDFPEDVISSADSDCCDHVLSSQFLKDDLRLDLKAELRFVTETSMSSNDGFSRETSSSSEICVDSEAMESPKQPASPQPVATSRRKPIKVSNLPTAAEIDEFFSVAEKKEQKRFTDKYNFDFVNDAPMEGRYQWVRLKP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001634`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001634

Location Chr01:30440311-30441326 (-)

Description Similar to KRP7: Cyclin-dependent kinase inhibitor 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49620`	Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity.	Arabidopsis KRPs have distinct inhibitory activity toward cyclin D2-associated kinases, including plant-specific B-type cyclin-dependent kinase.2006 · DOI: 10.1016/j.febslet.2005.12.018
`At5g48820`	Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity.	No verified direct reference in this release
`At3g19150`	Binds and inhibits CYCD2-1/CDKA-1 complex kinase activity.	Cyclin D1 and p22ack1 play opposite roles in plant growth and development.2004 · DOI: 10.1016/j.bbrc.2004.08.233 Overexpression of Arabidopsis ACK1 alters leaf morphology and retards growth and development.2005 · DOI: 10.1016/j.bbrc.2005.03.056 Targeted degradation of the cyclin-dependent kinase inhibitor ICK4/KRP6 by RING-type E3 ligases is essential for mitotic cell cycle progression during Arabidopsis gametogenesis.2008 · DOI: 10.1105/tpc.108.059741

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0471700`	Cyclin-dependent kinase inhibitor 4.	No verified direct reference in this release
`Os09g0459900`	Cyclin-dependent kinase inhibitor 6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001634 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045740 positive regulation of DNA replication Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0001673 male germ cell nucleus Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity Molecular Function

GO:0019900 kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G49620

ath:AT3G19150

ath:AT5G48820

dosa:Os09g0459900

dosa:Os10g0471700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · LXL04_001634 · OH-1004

Cytoplasm0.187

Rank 2 · LXL04_001634 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_001634 · OH-1004

Mitochondrion0.021

Rank 4 · LXL04_001634 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_001634 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02234.25CDI143-186 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001634	`PF02234.25`	CDI	143	186	1.3e-18	67.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94CL9`	Arabidopsis thaliana	Cyclin-dependent kinase inhibitor 7	46.296%	Swiss-Prot	moderate database homology
`Q9FKB5`	Arabidopsis thaliana	Cyclin-dependent kinase inhibitor 3	55.319%	Swiss-Prot	weak database homology
`Q0WNX9`	Arabidopsis thaliana	Cyclin-dependent kinase inhibitor 6	45.000%	Swiss-Prot	moderate database homology
`Q7XDH8`	Oryza sativa subsp. japonica	Cyclin-dependent kinase inhibitor 4	45.098%	Swiss-Prot	weak database homology
`Q67J15`	Oryza sativa subsp. japonica	Cyclin-dependent kinase inhibitor 6	50.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card