TkA01G519940 | RubberDandelionOmics

Gene overview

TkA01G519940

Reference: TK1151 Chr: Chr01 Coordinates: 130341017-130342498 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1482 bp · TkA01G519940|TK1151|cDNA

ATGGTCTATAAATGTCTTTTACCTTTCTCTTTACACTTCCAACTATTCCAATCTTTATCTTCCTTCCTAAAAACACCTTCCAATCATTCAATCTTTCTTGGAGTTCCATCATTCAAAGAAAAACCAGACGCCATTTCTTACTTCGAATTGCTTATCATGGCGAACGAGAAGTCCCGTGATCCATTGTTACCGGAGGAAAACTCTACCCACCGGCGAAAGAAGCTCGGAGTGCTTTTCCACACCTCCGAACCTAACATTAT...

CDS

Download CDS FASTA

1482 bp · TkA01G519940|TK1151|CDS

ATGGTCTATAAATGTCTTTTACCTTTCTCTTTACACTTCCAACTATTCCAATCTTTATCTTCCTTCCTAAAAACACCTTCCAATCATTCAATCTTTCTTGGAGTTCCATCATTCAAAGAAAAACCAGACGCCATTTCTTACTTCGAATTGCTTATCATGGCGAACGAGAAGTCCCGTGATCCATTGTTACCGGAGGAAAACTCTACCCACCGGCGAAAGAAGCTCGGAGTGCTTTTCCACACCTCCGAACCTAACATTAT...

Protein

Download Protein FASTA

493 aa · TkA01G519940|TK1151|PROTEIN

MVYKCLLPFSLHFQLFQSLSSFLKTPSNHSIFLGVPSFKEKPDAISYFELLIMANEKSRDPLLPEENSTHRRKKLGVLFHTSEPNIIFPAGEEQQEASTSSHHHNSNVSIRNPSLSPNMSPVNYFMSPLHQTSPFSKSPWQWNLSNMNAQGGNQTTGLIGSLVREEGHVYSLASSGDLLYTGSDSKNIRVWRNLAEFSGFKSSSGLVKAIVVSRDRIFTGHQDGKIRVWKFSDSMRKAHKRIGSLPTTMDFIKSSINPGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G519940`
TK1151 ID	TkA01G519940
OH-1004 ID	LXL04_001669
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G519940

Location Chr01:130341017-130342498 (+)

Description Similar to JGB: Protein JINGUBANG

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26490`	Negative regulator of pollen germination.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001669 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006935 chemotaxis Biological Process

GO:0009846 pollen germination Biological Process

GO:0031037 myosin II filament disassembly Biological Process

GO:1903013 response to differentiation-inducing factor 1 Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005826 actomyosin contractile ring Cellular Component

GO:0005938 cell cortex Cellular Component

GO:0032154 cleavage furrow Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT2G26490

ddi:DDB_G0289115

ddi:DDB_G0290687

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.406

Rank 1 · TkA01G519940 · TK1151

Cytoplasm0.406

Rank 2 · TkA01G519940 · TK1151

Cell membrane0.172

Rank 3 · TkA01G519940 · TK1151

Lysosome / Vacuole0.081

Rank 4 · TkA01G519940 · TK1151

Golgi apparatus0.067

Rank 5 · TkA01G519940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23409Beta-prop_EML67-93 aa

PF24017Beta-prop_SCAP149-393 aa

PF24105Beta-prop_CAF1B_HIR1152-197 aa

PF25173Beta-prop_WDR3_1st161-192 aa

PF25047Beta-prop_TEP1_2nd161-192 aa

PF24817WD40_WDHD1_1st162-255 aa

PF23393Beta-prop_WDR90_POC16_2nd164-215 aa

PF11715Beta-prop_Nup120_160165-316 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G519940	`PF23409`	Beta-prop_EML	67	93	1.2e-13	51.9
TkA01G519940	`PF24017`	Beta-prop_SCAP	149	393	1.4e-16	61.1
TkA01G519940	`PF24105`	Beta-prop_CAF1B_HIR1	152	197	1.4e-05	25.0
TkA01G519940	`PF25173`	Beta-prop_WDR3_1st	161	192	5.8e-33	114.9
TkA01G519940	`PF25047`	Beta-prop_TEP1_2nd	161	192	2.4e-19	70.2
TkA01G519940	`PF24817`	WD40_WDHD1_1st	162	255	1.3e-19	71.2
TkA01G519940	`PF23393`	Beta-prop_WDR90_POC16_2nd	164	215	6.3e-05	23.1
TkA01G519940	`PF11715`	Beta-prop_Nup120_160	165	316	0.0015	18.0
TkA01G519940	`PF00400`	WD40	166	191	2.8e-37	126.3
TkA01G519940	`PF25171`	Beta-prop_WDR36-Utp21_1st	166	242	3.2e-09	37.3
TkA01G519940	`PF25048`	Beta-prop_TEP1_C	167	193	1.1e-13	51.7
TkA01G519940	`PF23414`	Beta-prop_EML_2	169	252	3.5e-13	50.3
TkA01G519940	`PF25172`	Beta-prop_WDR3_2nd	170	193	1.7e-21	77.4
TkA01G519940	`PF25391`	WD40_Gbeta	171	200	4.2e-15	56.3
TkA01G519940	`PF23754`	Beta-prop_IP5PC_F	171	192	1.4e-09	38.1
TkA01G519940	`PF20426`	NBCH_WD40	171	193	1.6e-09	37.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48716`	Arabidopsis thaliana	sp\|O48716\|JGB_ARATH Protein JINGUBANG	56.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card