TkA01G519370 | RubberDandelionOmics

Gene overview

TkA01G519370

Reference: TK1151 Chr: Chr01 Coordinates: 130204454-130205269 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA01G519370|TK1151|cDNA

ATGTTTGATGATGCATTGTGGAAGAACAAAAGCGCATATATATCAAAGCCTTCCTCTCAGATGTCAAGCCTGCTCTTCTTACTGCAGTCGATTCAGAGTGCCAAAAAAACCCCTTTGAGGTTTGGCCGTGTTTTTGTGCAGGTGCGGTACCAAAGAAGACGGTTAGGGCATCATCTGTGTCTGTGTCTGGTGGTGGGTTGGATTGCTTCACATGAGGACATTAGTGCAATGATCACACCAACCCTTCTCAAAAAAATCGG...

CDS

Download CDS FASTA

339 bp · TkA01G519370|TK1151|CDS

ATGTTTGATGATGCATTGTGGAAGAACAAAAGCGCATATATATCAAAGCCTTCCTCTCAGATGTCAAGCCTGCTCTTCTTACTGCAGTCGATTCAGAGTGCCAAAAAAACCCCTTTGAGGTTTGGCCGTGTTTTTGTGCAGGTGCGGTACCAAAGAAGACGGTTAGGGCATCATCTGTGTCTGTGTCTGGTGGTGGGTTGGATTGCTTCACATGAGGACATTAGTGCAATGATCACACCAACCCTTCTCAAAAAAATCGG...

Protein

Download Protein FASTA

112 aa · TkA01G519370|TK1151|PROTEIN

MFDDALWKNKSAYISKPSSQMSSLLFLLQSIQSAKKTPLRFGRVFVQVRYQRRRLGHHLCLCLVVGWIASHEDISAMITPTLLKKIGSSDWKIRLESIEAENIIVEEANERI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G519370`
TK1151 ID	TkA01G519370
OH-1004 ID	LXL04_027601
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.000
Protein coverage (%)	TK1151 36.607 / OH-1004 2.053 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G519370

Location Chr01:130204454-130205269 (-)

Description Similar to MOR1: Protein MOR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35630`	Microtubule-binding protein that is essential for cortical microtubules organization and function.	MOR1 is essential for organizing cortical microtubules in plants.2001 · DOI: 10.1038/35079128 Mutation or drug-dependent microtubule disruption causes radial swelling without altering parallel cellulose microfibril deposition in Arabidopsis root cells.2003 · DOI: 10.1105/tpc.011593 Genetic analysis of adventitious root formation with a novel series of temperature-sensitive mutants of Arabidopsis thaliana.2003 · DOI: 10.1242/dev.00794 Cellulose microfibril alignment recovers from DCB-induced disruption despite microtubule disorganization.2003 · DOI: 10.1046/j.1365-313x.2003.01906.x Aberrant cell plate formation in the Arabidopsis thaliana microtubule organization 1 mutant.2005 · DOI: 10.1093/pcp/pci068 MICROTUBULE ORGANIZATION 1 regulates structure and function of microtubule arrays during mitosis and cytokinesis in the Arabidopsis root.2006 · DOI: 10.1104/pp.105.069989 Hypersensitivity to cytoskeletal antagonists demonstrates microtubule-microfilament cross-talk in the control of root elongation in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1469-8137.2006.01671.x MOR1, the Arabidopsis thaliana homologue of Xenopus MAP215, promotes rapid growth and shrinkage, and suppresses the pausing of microtubules in vivo.2008 · DOI: 10.1242/jcs.039065

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0816400`	Microtubule-associated protein that is essential for cortical microtubules organization and function.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027601 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0002181 cytoplasmic translation Biological Process

GO:0007019 microtubule depolymerization Biological Process

GO:0007051 spindle organization Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0007098 centrosome cycle Biological Process

GO:0009920 cell plate formation involved in plant-type cell wall biogenesis Biological Process

GO:0010609 mRNA localization resulting in post-transcriptional regulation of gene expression Biological Process

GO:0022618 protein-RNA complex assembly Biological Process

GO:0030951 establishment or maintenance of microtubule cytoskeleton polarity Biological Process

GO:0045807 positive regulation of endocytosis Biological Process

KEGG gene cross-reference

ath:AT2G35630

dosa:Os01g0816400

hsa:9793

mmu:75786

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.444

Rank 1 · TkA01G519370 · TK1151

Cytoplasm0.382

Rank 2 · TkA01G519370 · TK1151

Mitochondrion0.164

Rank 3 · TkA01G519370 · TK1151

Cell membrane0.068

Rank 4 · TkA01G519370 · TK1151

Endoplasmic reticulum0.063

Rank 5 · TkA01G519370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94FN2`	Arabidopsis thaliana	sp\|Q94FN2\|MOR1_ARATH Protein MOR1	70.700%	Swiss-Prot	Low
`Q5N749`	Oryza sativa subsp. japonica	sp\|Q5N749\|MOR1_ORYSJ Protein MOR1	73.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card