TkA01G519130 | RubberDandelionOmics

Gene overview

TkA01G519130

Reference: TK1151 Chr: Chr01 Coordinates: 130131617-130135452 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2024 bp · TkA01G519130|TK1151|cDNA

GATAAACACACTTTTAGACCAATTCATTTGTTATGTTATAAACAAACAAAATTACGCCGGCCAAATTTCTTAGGAATGAAAGACTCGATTGCGGCGTGTTTATTGTTCGTGCTTCCCATCGCCATTAATCTCCTACCATTTCCCCCGTTTCTTGATTTCCCGATCATCACAAACTTAACAAATTCATCCATTTTTTATAATTCTTATTCAAAATGCACCCTAACCCTAACTCCATTCTCGACGAAAGCCAGTTCCCAGAA...

CDS

Download CDS FASTA

1665 bp · TkA01G519130|TK1151|CDS

ATGCACCCTAACCCTAACTCCATTCTCGACGAAAGCCAGTTCCCAGAATACAAATCCTTTGAAGAGTACGAACAGGTGTACGATCAGTTTCCGGAAATGGAGAGCGCCGCCGTCGACGAAGAACTCCCTCCGTTGGAAGACGTAAACAGCACCATCGATAGTTACTGCAACCAGTTCGATTCACACCCATTGTCCCAAGACCAGACACCGGTCTCGATACCGGAACTCGACCAATTAACTAAGGGAGTTACAGATTCGGC...

Protein

Download Protein FASTA

554 aa · TkA01G519130|TK1151|PROTEIN

MHPNPNSILDESQFPEYKSFEEYEQVYDQFPEMESAAVDEELPPLEDVNSTIDSYCNQFDSHPLSQDQTPVSIPELDQLTKGVTDSALKSNLAYPEHNSPASLELLSCIRSKFKHLPKASTDETVPESAGKLSTVEIIELAAEKFIKFSTQRVSGYTMFTHPYGSSAFTSLSIDETREVELVFQLLTAAEKVCRKQFDIACKFITRCGWVASDSGSPVERLVFYFCEALKKRIGEETGVPFATKREKLGLKNENPMAMGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G519130`
TK1151 ID	TkA01G519130
OH-1004 ID	LXL04_001687
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	78.900
Protein coverage (%)	TK1151 99.278 / OH-1004 99.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G519130

Location Chr01:130131617-130135452 (-)

Description Similar to GAI1: DELLA protein GAI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50650`	Probable transcription factor involved in plant development (Probable).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001687 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007584 response to nutrient Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009938 negative regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010247 detection of phosphate ion Biological Process

KEGG gene cross-reference

ath:AT1G66350

mtr:11438339

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.648

Rank 1 · TkA01G519130 · TK1151

Cytoplasm0.402

Rank 2 · TkA01G519130 · TK1151

Cell membrane0.054

Rank 3 · TkA01G519130 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA01G519130 · TK1151

Plastid0.035

Rank 5 · TkA01G519130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03514GRAS184-552 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G519130	`PF03514`	GRAS	184	552	5.9e-84	282.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCR0`	Arabidopsis thaliana	sp\|Q9SCR0\|SCL7_ARATH Scarecrow-like protein 7	26.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card