TkA01G516060 | RubberDandelionOmics

Gene overview

TkA01G516060

Reference: TK1151 Chr: Chr01 Coordinates: 129356566-129358822 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

735 bp · TkA01G516060|TK1151|CDS

ATGCTTCAGATTGAGAATGAATTTGGTTCATATGGAGTTGACAAAGACTATCTGCACCATCTGGTCAACTTAGCACGGTCACATCTCGGGGACGACCTAATTTTTTATTTCTTTCTAAAAGATGGGAAGGTTTATCGAACTTTGAGTCTAATAATACCCATTTTCTTGATAGAATTTTACATGGGTTGGCTTACACATTGGGGAGAGAATATGGCTAAAACTGATGCTTTTTCTACAGCATCTGCCCTGGAAATTATTCT...

Protein

Download Protein FASTA

244 aa · TkA01G516060|TK1151|PROTEIN

MLQIENEFGSYGVDKDYLHHLVNLARSHLGDDLIFYFFLKDGKVYRTLSLIIPIFLIEFYMGWLTHWGENMAKTDAFSTASALEIILSRNGSAMLYMAHGGTNFGFYNGANAQESESNYLADLTSYDYDVPISESGDVDGAKFKALRSVIAMYSAASLPPVPKNNEKTGYGGIKLEKTSSLFDILDSNLLTKAIESDNPISMEAAGQMFGFLLYTSEYTAKGKESTLSIPKVPIEPKCMLHAFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G516060`
TK1151 ID	TkA01G516060
OH-1004 ID	LXL04_001728
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 99.590 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G516060

Location Chr01:129356566-129358822 (-)

Description Similar to BGAL17: Beta-galactosidase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72990`	Beta-galactosidase 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0539400`	Beta-galactosidase 8.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001728 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006516 glycoprotein catabolic process Biological Process

GO:0006689 ganglioside catabolic process Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0042340 keratan sulfate proteoglycan catabolic process Biological Process

GO:0051413 response to cortisone Biological Process

GO:1904016 response to Thyroglobulin triiodothyronine Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G72990

ddi:DDB_G0290217

dosa:Os05g0539400

hsa:2720

pon:100173272

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.707

Rank 1 · TkA01G516060 · TK1151

Cytoplasm0.143

Rank 2 · TkA01G516060 · TK1151

Nucleus0.064

Rank 3 · TkA01G516060 · TK1151

Endoplasmic reticulum0.030

Rank 4 · TkA01G516060 · TK1151

Lysosome / Vacuole0.024

Rank 5 · TkA01G516060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01301Glyco_hydro_351-34 aa

PF01301Glyco_hydro_3550-152 aa

PF21317BetaGal_ABD_1199-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G516060	`PF01301`	Glyco_hydro_35	1	34	4.9e-33	115.8
TkA01G516060	`PF01301`	Glyco_hydro_35	50	152	4.9e-33	115.8
TkA01G516060	`PF21317`	BetaGal_ABD_1	199	226	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z24`	Arabidopsis thaliana	sp\|Q93Z24\|BGA17_ARATH Beta-galactosidase 17	52.600%	Swiss-Prot	High
`Q0DGD7`	Oryza sativa subsp. japonica	sp\|Q0DGD7\|BGAL8_ORYSJ Beta-galactosidase 8	52.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card