TkA01G515800 | RubberDandelionOmics

Gene overview

TkA01G515800

Reference: TK1151 Chr: Chr01 Coordinates: 129259944-129263636 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1119 bp · TkA01G515800|TK1151|cDNA

ATGGATGAACAACCGAGTGTGGAGCTGCACTACCAAGGGACCTTCATACCAGAACCGTTGGTGTATTTCGACCCTAAAATCGTTTCTATAACTGACATTGATCTACAATCGATGTCCTACGCAAGTTTCGTCTCTCATATTGAAAAGGTCATTGATATGCGATGCAAGTATTTGTACTTTTGTCTCCCATCTGAAGCGAGACTGTCTCGGGGAATACAGGCTCTGCAGAATGAATGTGACTTTAGCGAGTTTGTTGACGC...

CDS

Download CDS FASTA

1119 bp · TkA01G515800|TK1151|CDS

ATGGATGAACAACCGAGTGTGGAGCTGCACTACCAAGGGACCTTCATACCAGAACCGTTGGTGTATTTCGACCCTAAAATCGTTTCTATAACTGACATTGATCTACAATCGATGTCCTACGCAAGTTTCGTCTCTCATATTGAAAAGGTCATTGATATGCGATGCAAGTATTTGTACTTTTGTCTCCCATCTGAAGCGAGACTGTCTCGGGGAATACAGGCTCTGCAGAATGAATGTGACTTTAGCGAGTTTGTTGACGC...

Protein

Download Protein FASTA

372 aa · TkA01G515800|TK1151|PROTEIN

MDEQPSVELHYQGTFIPEPLVYFDPKIVSITDIDLQSMSYASFVSHIEKVIDMRCKYLYFCLPSEARLSRGIQALQNECDFSEFVDAATGSKVNVYVDHDDEPIFEWIALELPEEDEAEDEDEEDEEVIPDGEKDHEEDEEVPSIRRTVNDHFLNKLCPVENDFEEGDEALPNYPRHDKTQAWNKMEPELGMHFSSPSELKACLSNYSVANGYDLWYDRNDKHRLLVKCCKGKTPQCPFRLWASWMKEERTFQIKSLKKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G515800`
TK1151 ID	TkA01G515800
OH-1004 ID	LXL04_036164
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.700
Protein coverage (%)	TK1151 100.000 / OH-1004 53.455 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G515800`
Location	Chr01:129259944-129263636 (+)
Description	Similar to WRKY49: Probable WRKY transcription factor 49
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_036164` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009863 salicylic acid mediated signaling pathway Biological Process GO:0010055 atrichoblast differentiation Biological Process GO:0032107 regulation of response to nutrient levels Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0048527 lateral root development Biological Process
KEGG gene cross-reference	ath:AT1G69310 ath:AT2G04880 ath:AT5G13080 ath:AT5G43290 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.922

Rank 1 · TkA01G515800 · TK1151

Cytoplasm0.131

Rank 2 · TkA01G515800 · TK1151

Cell membrane0.031

Rank 3 · TkA01G515800 · TK1151

Endoplasmic reticulum0.027

Rank 4 · TkA01G515800 · TK1151

Mitochondrion0.012

Rank 5 · TkA01G515800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26130PB1-like1-99 aa

PF08111Pea-VEAacid90-97 aa

PF03108DBD_Tnp_Mut190-254 aa

PF08731AFT194-232 aa

PF08731AFT230-262 aa

PF08111Pea-VEAacid315-324 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G515800	`PF26130`	PB1-like	1	99	5.3e-05	24.1
TkA01G515800	`PF08111`	Pea-VEAacid	90	97	0.072	14.1
TkA01G515800	`PF03108`	DBD_Tnp_Mut	190	254	1.2e-10	41.6
TkA01G515800	`PF08731`	AFT	194	232	0.045	14.8
TkA01G515800	`PF08731`	AFT	230	262	0.045	14.8
TkA01G515800	`PF08111`	Pea-VEAacid	315	324	0.072	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card