RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G512070
Reference: TK1151 Chr: Chr01 Coordinates: 128327363-128332405 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4662 bp · TkA01G512070|TK1151|cDNA

TTGAAACTCAAATCATGAAACCTGCGACCCAAATGGTGAAGAGAGAAAATGGAGATTCTGCTGTAGAAATTAAAAACCCAATCGTCCAAATTGTCAGGCCCAGCAACAATAGCGGATATTGCGATCTCAACTTTAAGGAATTCACTCAAATGTCTCGTCTCTATCCCACATGTGGGTTCGGTATAAAGCAACAGAGCAACGACACAGTGCCCCCAAATTCTTTCAACCAATTATAGAAACCACGATCATCATGGAAAAGA...

CDS

Download CDS FASTA

3351 bp · TkA01G512070|TK1151|CDS

ATGAGGAATCTAGATTTTGAAAAACATTCTTTCCCCTTGTTGCTACTCATGTTATCGATCACTGTCCTTGTTGATTCAATAAACGAAGAAGGTGCTGTCCTTTTGGAGTTTAGATTCTCTCTTTCTGACCCAAATAACAATCTCCGTACATGGAATAATCAATCCGATTCATTTCCTTGTAATTGGATTGGTATAAACTGTACCATTGATCACAAGGTAACGTCTATAAACCTCAGTAACCTTAATCTATCCGGCTCTCT...

Protein

Download Protein FASTA

1116 aa · TkA01G512070|TK1151|PROTEIN

MRNLDFEKHSFPLLLLMLSITVLVDSINEEGAVLLEFRFSLSDPNNNLRTWNNQSDSFPCNWIGINCTIDHKVTSINLSNLNLSGSLSPTICKLPFLTDFNISKNFISGPIPNLSSCQHLEVVDLCTNRFHDDFPSQISTVSTLRVLSLCENYISGVIPEDIQNLASLEELVVYSNNLTGSIPKSIGRLKKLRIIRAGVNSLSGPIPSEISECENLKVLGLAQNNLEGPIPKELQNLEHLTSLVLWQNVLSGEIPPEIGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G512070
TK1151 IDTkA01G512070
OH-1004 IDLXL04_001783
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G512070
LocationChr01:128327363-128332405 (+)
DescriptionSimilar to At1g17230: Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g17230 Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230. No verified direct reference in this release
At5g63930 Probable leucine-rich repeat receptor-like protein kinase At5g63930. No verified direct reference in this release
At2g33170 Probable leucine-rich repeat receptor-like protein kinase At2g33170. No verified direct reference in this release
At3g49670 LRR-rich receptor-like kinase (LRR-RLK) implicated in the detection of the CLAVATA-family peptides (CLEs), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36. No verified direct reference in this release
At4g20270 LRR-rich receptor-like kinase (LRR-RLK) that, similarly to BAM1 and CLV1, participates in the detection of CLAVATA-family peptides (e.g. CLE25, CLE26 and CLE45), and to the regulation of the triggered signaling required for protophloem differentiation and meristems maintenance through the phosphorylation of CIK proteins (CIKs) and, probably, of PBL34, PBL35 and PBL36. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_001783 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0010074 maintenance of meristem identity Biological Process
GO:0010078 maintenance of root meristem identity Biological Process
GO:0010082 regulation of root meristem growth Biological Process
GO:0010449 root meristem growth Biological Process
GO:2000280 regulation of root development Biological Process
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0001653 peptide receptor activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0038023 signaling receptor activity Molecular Function
KEGG gene cross-reference
ath:AT1G17230
ath:AT1G34110
ath:AT2G33170
ath:AT5G48940
ath:AT5G63930
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.862
Rank 1 · TkA01G512070 · TK1151
Endoplasmic reticulum0.087
Rank 2 · TkA01G512070 · TK1151
Cytoplasm0.062
Rank 3 · TkA01G512070 · TK1151
Nucleus0.036
Rank 4 · TkA01G512070 · TK1151
Lysosome / Vacuole0.031
Rank 5 · TkA01G512070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_228-68 aa
PF25019LRR_R13L1-DRL2147-103 aa
PF25013LRR_Zer-165-104 aa
PF23211LRR_LRWD172-149 aa
PF00560LRR_173-94 aa
PF13855LRR_873-108 aa
PF12799LRR_473-115 aa
PF24048LRR_NXF1-573-145 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G512070PF08263LRRNT_228682.8e-1041.0
TkA01G512070PF25019LRR_R13L1-DRL21471030.08213.5
TkA01G512070PF25013LRR_Zer-1651040.00418.0
TkA01G512070PF23211LRR_LRWD1721497.3e-0626.5
TkA01G512070PF00560LRR_173945.6e-53166.1
TkA01G512070PF13855LRR_8731082.5e-36124.0
TkA01G512070PF12799LRR_4731151.6e-2692.4
TkA01G512070PF24048LRR_NXF1-5731457.76.9
TkA01G512070PF00560LRR_1971135.6e-53166.1
TkA01G512070PF12799LRR_4971301.6e-2692.4
TkA01G512070PF23598LRR_141112439.7e-45153.6
TkA01G512070PF24758LRR_At5g563701131550.000420.8
TkA01G512070PF00560LRR_11191395.6e-53166.1
TkA01G512070PF13855LRR_81191782.5e-36124.0
TkA01G512070PF25019LRR_R13L1-DRL211331730.08213.5
TkA01G512070PF23286LRR_131362200.5810.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SHI2Arabidopsis thalianasp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g1723060.000%Swiss-ProtLow
Q9LVP0Arabidopsis thalianasp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g6393051.000%Swiss-ProtLow
O49318Arabidopsis thalianasp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g3317051.600%Swiss-ProtLow
Q9M2Z1Arabidopsis thalianasp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM243.500%Swiss-ProtLow
O65440Arabidopsis thalianasp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM345.000%Swiss-ProtLow

JBrowse

View in Genome Browser