LXL04_001783 | RubberDandelionOmics

Gene overview

LXL04_001783

Reference: OH-1004 Chr: Chr01 Coordinates: 33326553-33330292 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3354 bp · LXL04_001783|LXL04_001783|OH1004|cDNA

ATGAGGAATCTAGATTTTGAAAAACATTTTTTCCCCTTGTTGCTACTCATGTTATCGATCACTGTCCTTGTTGATTCAATAAACGAAGAAGGTGCTGTCCTTTTGGAGTTCAGATTCTCTCTTTCTGACCCAAATAACAATCTCCGTACATGGAATAATCAATCCGATTCATTTCCTTGTAATTGGATTGGTATAAACTGTACCATTGATCACAAGGTAACGTCTATAAACCTCAGTAACCTTAATCTATCCGGCTCTCT...

CDS

Download CDS FASTA

3354 bp · LXL04_001783|LXL04_001783|OH1004|CDS

ATGAGGAATCTAGATTTTGAAAAACATTTTTTCCCCTTGTTGCTACTCATGTTATCGATCACTGTCCTTGTTGATTCAATAAACGAAGAAGGTGCTGTCCTTTTGGAGTTCAGATTCTCTCTTTCTGACCCAAATAACAATCTCCGTACATGGAATAATCAATCCGATTCATTTCCTTGTAATTGGATTGGTATAAACTGTACCATTGATCACAAGGTAACGTCTATAAACCTCAGTAACCTTAATCTATCCGGCTCTCT...

Protein

Download Protein FASTA

1117 aa · LXL04_001783|LXL04_001783|OH1004|PROTEIN

MRNLDFEKHFFPLLLLMLSITVLVDSINEEGAVLLEFRFSLSDPNNNLRTWNNQSDSFPCNWIGINCTIDHKVTSINLSNLNLSGSLSPTICKLPFLTDFNISKNFISGPIPNLSSCQHLEVVDLCTNRFHDDFPSQISTVSTLRVLSLCENYISGVIPEDIQNLASLEELVVYSNNLTGSIPKSIGRLKKLRIIRAGVNSLSGPIPSEISECENLEVLGLAQNNLEGPIPKELQNLEHLTSLVLWQNVLSGEIPPEIGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001783`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001783

Location Chr01:33326553-33330292 (-)

Description Similar to At1g17230: Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At2g33170`	Probable leucine-rich repeat receptor-like protein kinase At2g33170.	No verified direct reference in this release
`At1g34110`	Together with RGI1, RGI2, RGI3 and RGI4, acts as a receptor of RGF1, a peptide hormone that maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001783 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010078 maintenance of root meristem identity Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010449 root meristem growth Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0001653 peptide receptor activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0038023 signaling receptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G17230

ath:AT1G34110

ath:AT2G33170

ath:AT5G48940

ath:AT5G63930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.862

Rank 1 · LXL04_001783 · OH-1004

Endoplasmic reticulum0.086

Rank 2 · LXL04_001783 · OH-1004

Cytoplasm0.062

Rank 3 · LXL04_001783 · OH-1004

Nucleus0.035

Rank 4 · LXL04_001783 · OH-1004

Lysosome / Vacuole0.031

Rank 5 · LXL04_001783 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_228-68 aa

PF23598.2LRR_14111-244 aa

PF13855.13LRR_8119-178 aa

PF23598.2LRR_14209-342 aa

PF13855.13LRR_8263-322 aa

PF23598.2LRR_14472-554 aa

PF13855.13LRR_8500-557 aa

PF23598.2LRR_14543-651 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001783	`PF08263.18`	LRRNT_2	28	68	2.8e-10	41.0
LXL04_001783	`PF23598.2`	LRR_14	111	244	1.9e-44	152.6
LXL04_001783	`PF13855.13`	LRR_8	119	178	2.8e-36	123.8
LXL04_001783	`PF23598.2`	LRR_14	209	342	1.9e-44	152.6
LXL04_001783	`PF13855.13`	LRR_8	263	322	2.8e-36	123.8
LXL04_001783	`PF23598.2`	LRR_14	472	554	1.9e-44	152.6
LXL04_001783	`PF13855.13`	LRR_8	500	557	2.8e-36	123.8
LXL04_001783	`PF23598.2`	LRR_14	543	651	1.9e-44	152.6
LXL04_001783	`PF00069.32`	Pkinase	805	1078	9.6e-45	153.7
LXL04_001783	`PF07714.24`	PK_Tyr_Ser-Thr	808	1024	1.8e-40	139.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHI2`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	62.881%	Swiss-Prot	strong database homology
`Q9LVP0`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g63930	51.974%	Swiss-Prot	strong database homology
`O49318`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At2g33170	51.300%	Swiss-Prot	strong database homology
`C0LGF5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI5	40.292%	Swiss-Prot	moderate database homology
`C0LGV1`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI2	38.919%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card