TkA01G504500 | RubberDandelionOmics

Gene overview

TkA01G504500

Reference: TK1151 Chr: Chr01 Coordinates: 126316780-126319099 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2249 bp · TkA01G504500|TK1151|cDNA

TTTGAATCGTATTTTTCATCAAAGTTTGTATGCTTCTATAAAATCCAAAATCTGTTTTCATTAAATCCAAAGAAATTCGGACAAGAATAATCCATTTTGGAGATTGCGTTCTATTCATCTGAATCGTCTTCTCCATTTAACCCCTTTTCCTCCCCCAATCAATTGATAAACCCTAATTATCTTCCAATTACAAAGGAAATGCTATTTCGCGACAGCCGCCTCTATCTTCAATCTCCATATTCAAGTTATCAAAACCCCAA...

CDS

Download CDS FASTA

1695 bp · TkA01G504500|TK1151|CDS

ATGTCCGATTTGGATGATATTGACCTCGGCCCAGAAGACTTTCTATCATCAGTCCCACTGAAAAAAGTTCCATACGGCGATGTTTTTGAAGCTTCTCGCGCCGGCGACGTCGACCGGTTGAAATACCTATTGGAGTCCGGTGTAAATGTAAACGCGCGCGACCAGTGGGACTCGGTGGCTCTGTACTACGCTTGTTTAGCAGGGCATCTTGATGCCGCCAAGATGTTGCTAGAAAACGGCGCAATTTGCTCCGAACACAC...

Protein

Download Protein FASTA

564 aa · TkA01G504500|TK1151|PROTEIN

MSDLDDIDLGPEDFLSSVPLKKVPYGDVFEASRAGDVDRLKYLLESGVNVNARDQWDSVALYYACLAGHLDAAKMLLENGAICSEHTFDGDRCHYASLNLKVRKLLKAFEARPPPLGPLQGALRETFLACVANRGFIEQLDDQSNLTGNLSNGGPNPGYFPPDVVFYLHGRPIEAHRVILSARSPYLKNKFENEWRNRKEIRFSREKLSFPAFYSLIHFFYSDRLEIAVDDMDDLARICKVCKCESLQKVIEKEVSHHKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G504500`
TK1151 ID	TkA01G504500
OH-1004 ID	LXL04_001841
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G504500

Location Chr01:126316780-126319099 (+)

Description Similar to At2g04740: BTB/POZ domain-containing protein At2g04740

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04740`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001841 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G04740

hsa:80325

mmu:80283

rno:297432

spo:2542872

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.601

Rank 1 · TkA01G504500 · TK1151

Nucleus0.328

Rank 2 · TkA01G504500 · TK1151

Cell membrane0.119

Rank 3 · TkA01G504500 · TK1151

Mitochondrion0.072

Rank 4 · TkA01G504500 · TK1151

Golgi apparatus0.068

Rank 5 · TkA01G504500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13637Ank_429-77 aa

PF00023Ank31-54 aa

PF12796Ank_231-96 aa

PF13606Ank_331-52 aa

PF13857Ank_543-90 aa

PF00023Ank60-81 aa

PF13606Ank_360-82 aa

PF00651BTB162-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G504500	`PF13637`	Ank_4	29	77	2.7e-09	37.8
TkA01G504500	`PF00023`	Ank	31	54	1.5e-07	32.0
TkA01G504500	`PF12796`	Ank_2	31	96	2e-07	32.2
TkA01G504500	`PF13606`	Ank_3	31	52	0.00019	22.3
TkA01G504500	`PF13857`	Ank_5	43	90	6.7e-06	27.1
TkA01G504500	`PF00023`	Ank	60	81	1.5e-07	32.0
TkA01G504500	`PF13606`	Ank_3	60	82	0.00019	22.3
TkA01G504500	`PF00651`	BTB	162	258	1.1e-32	113.2
TkA01G504500	`PF07707`	BACK	236	258	0.045	14.5
TkA01G504500	`PF07707`	BACK	258	279	0.045	14.5
TkA01G504500	`PF00651`	BTB	327	431	1.1e-32	113.2
TkA01G504500	`PF11822`	BTB_SANBR	337	401	0.16	13.0
TkA01G504500	`PF07707`	BACK	389	443	0.045	14.5
TkA01G504500	`PF07707`	BACK	446	484	0.045	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ85`	Arabidopsis thaliana	sp\|Q9SJ85\|Y2474_ARATH BTB/POZ domain-containing protein At2g04740	70.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card