LXL04_001841 | RubberDandelionOmics

Gene overview

LXL04_001841

Reference: OH-1004 Chr: Chr01 Coordinates: 34864635-34866400 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1695 bp · LXL04_001841|LXL04_001841|OH1004|cDNA

ATGTCCGATTTGGATGATATTGACCTCGGCCCAGAAGACTTTCTATCATCAGTCCCACTGAAAAAAGTTCCATACGGCGATGTTTTTGAAGCTTCTCGCGCCGGCGACGTCGACCGCTTGAAATACCTATTGGAGTCCGGTGTAAATGTAAACGCGCGCGACCAGTGGGACTCGGTGGCTCTGTACTACGCTTGTTTAGCAGGGCATCTTGATGCCGCCAAGATGTTGCTAGAAAACGGTGCAATTTGCTCCGAACACAC...

CDS

Download CDS FASTA

1695 bp · LXL04_001841|LXL04_001841|OH1004|CDS

ATGTCCGATTTGGATGATATTGACCTCGGCCCAGAAGACTTTCTATCATCAGTCCCACTGAAAAAAGTTCCATACGGCGATGTTTTTGAAGCTTCTCGCGCCGGCGACGTCGACCGCTTGAAATACCTATTGGAGTCCGGTGTAAATGTAAACGCGCGCGACCAGTGGGACTCGGTGGCTCTGTACTACGCTTGTTTAGCAGGGCATCTTGATGCCGCCAAGATGTTGCTAGAAAACGGTGCAATTTGCTCCGAACACAC...

Protein

Download Protein FASTA

564 aa · LXL04_001841|LXL04_001841|OH1004|PROTEIN

MSDLDDIDLGPEDFLSSVPLKKVPYGDVFEASRAGDVDRLKYLLESGVNVNARDQWDSVALYYACLAGHLDAAKMLLENGAICSEHTFDGDRCHYASLNLKVRKLLKAFEARPPPLGPLQGALRETFLACVANRGFIEQLDDQSNLTGNLSNGGPNPGYFPPDVVFYLHGRPIEAHRVILSARSPYLKNKFENEWRNRKEIRFSREKLSFPAFYSLIHFFYSDRLEIAVDDMDDLARICKVCKCESLQKVIEKEVSHHKY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001841`
TK1151 ID	TkA01G504500
OH-1004 ID	LXL04_001841
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001841

Location Chr01:34864635-34866400 (-)

Description Similar to At2g04740: BTB/POZ domain-containing protein At2g04740

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04740`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001841 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0031347 regulation of defense response Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G04740

hsa:80325

mmu:80283

rno:297432

spo:2542872

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.601

Rank 1 · LXL04_001841 · OH-1004

Nucleus0.325

Rank 2 · LXL04_001841 · OH-1004

Cell membrane0.120

Rank 3 · LXL04_001841 · OH-1004

Mitochondrion0.074

Rank 4 · LXL04_001841 · OH-1004

Golgi apparatus0.069

Rank 5 · LXL04_001841 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13637.13Ank_429-77 aa

PF12796.14Ank_231-96 aa

PF13857.13Ank_543-90 aa

PF00651.38BTB162-258 aa

PF00651.38BTB327-431 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001841	`PF13637.13`	Ank_4	29	77	2.7e-09	37.8
LXL04_001841	`PF12796.14`	Ank_2	31	96	1.9e-07	32.3
LXL04_001841	`PF13857.13`	Ank_5	43	90	6e-06	27.2
LXL04_001841	`PF00651.38`	BTB	162	258	1.1e-32	113.2
LXL04_001841	`PF00651.38`	BTB	327	431	1.1e-32	113.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ85`	Arabidopsis thaliana	BTB/POZ domain-containing protein At2g04740	70.588%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card