TkA01G497730 | RubberDandelionOmics

Gene overview

TkA01G497730

Reference: TK1151 Chr: Chr01 Coordinates: 124606514-124641947 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5984 bp · TkA01G497730|TK1151|cDNA

ATGAACACACGCTCATTCAAGTACGCATGGGTGCTCGTCAAACTTAAGGCCGAGCATGAACGTGGTATCACCATGGATATTGCCCTCTGGAAGTTCGAAACCACCACGTACAACTGCACAGTCGTCGATGCCCCCGGACACCGTGATTTCATCAAGAACATGATTACTGGTACTTACCAGGCCGATTGCGCCGTTCTTATTGTCGATTCCACCACTGGAGGCTTCGAAACTGGTATTTCCAAGGATGGTCAGATCCCTGA...

CDS

Download CDS FASTA

939 bp · TkA01G497730|TK1151|CDS

ATGAACACACGCTCATTCAAGTACGCATGGGTGCTCGTCAAACTTAAGGCCGAGCATGAACGTGGTATCACCATGGATATTGCCCTCTGGAAGTTCGAAACCACCACGTACAACTGCACAGTCGTCGATGCCCCCGGACACCGTGATTTCATCAAGAACATGATTACTGGTACTTACCAGGCCGATTGCGCCGTTCTTATTGTCGATTCCACCACTGGAGGCTTCGAAACTGGTATTTCCAAGGATGGTCAGATCCCTGA...

Protein

Download Protein FASTA

312 aa · TkA01G497730|TK1151|PROTEIN

MNTRSFKYAWVLVKLKAEHERGITMDIALWKFETTTYNCTVVDAPGHRDFIKNMITGTYQADCAVLIVDSTTGGFETGISKDGQIPEHALLAFTTGMDATTPKYSKSRYEEIVKEVLIRMRPLSNMEEMAQGYGRCLKQESLQTLAWLGHLEVRFTFDHIVSETIITISQGKALQGAGLPMVDNCMSGYIWHVCLWSVAKIYNDGEISQQDGKLVDDCGITPRLSEYLFTRIKLEEENRRDERLKYSCKCSFLEIYNEKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G497730`
TK1151 ID	TkA01G497730
OH-1004 ID	LXL04_001930
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.100
Protein coverage (%)	TK1151 97.115 / OH-1004 25.312 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G497730

Location Chr01:124606514-124641947 (+)

Description Similar to KIN12C: Kinesin-like protein KIN-12C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17360`	Involved in the spatial control of cytokinesis by a proper phragmoplast guidance.	Two kinesins are involved in the spatial control of cytokinesis in Arabidopsis thaliana.2006 · DOI: 10.1016/j.cub.2006.03.034 Tangled localization at the cortical division site of plant cells occurs by several mechanisms.2011 · DOI: 10.1242/jcs.073676

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001930 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006412 translation Biological Process

GO:0006414 translational elongation Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009524 phragmoplast Cellular Component

GO:0032153 cell division site Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003746 translation elongation factor activity Molecular Function

GO:0003777 microtubule motor activity Molecular Function

KEGG gene cross-reference

ath:AT3G17360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.404

Rank 1 · TkA01G497730 · TK1151

Nucleus0.284

Rank 2 · TkA01G497730 · TK1151

Mitochondrion0.214

Rank 3 · TkA01G497730 · TK1151

Cell membrane0.079

Rank 4 · TkA01G497730 · TK1151

Endoplasmic reticulum0.065

Rank 5 · TkA01G497730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00009GTP_EFTU12-98 aa

PF01926MMR_HSR116-71 aa

PF03008DUF23498-137 aa

PF00225Kinesin119-303 aa

PF16796Microtub_bd152-264 aa

PF03008DUF234155-172 aa

PF01926MMR_HSR1209-227 aa

PF03008DUF234284-302 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G497730	`PF00009`	GTP_EFTU	12	98	1.5e-22	80.8
TkA01G497730	`PF01926`	MMR_HSR1	16	71	0.15	12.9
TkA01G497730	`PF03008`	DUF234	98	137	0.13	13.4
TkA01G497730	`PF00225`	Kinesin	119	303	3.9e-23	82.7
TkA01G497730	`PF16796`	Microtub_bd	152	264	0.0022	18.6
TkA01G497730	`PF03008`	DUF234	155	172	0.13	13.4
TkA01G497730	`PF01926`	MMR_HSR1	209	227	0.15	12.9
TkA01G497730	`PF03008`	DUF234	284	302	0.13	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q27IK7`	Arabidopsis thaliana	sp\|Q27IK7\|KN12C_ARATH Kinesin-like protein KIN-12C	56.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card