TkA01G494620 | RubberDandelionOmics

Gene overview

TkA01G494620

Reference: TK1151 Chr: Chr01 Coordinates: 123790967-123793331 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1471 bp · TkA01G494620|TK1151|cDNA

GAGTGACACACCCACTATCTCTTACAAAGATGCAGACACCAACAAATGTGACGATAAAGGGAATTCTTGCTACTCTAATGGCAAGTCTTGATGAGAAAAACAATAAGAAGGTAATCTGTTTAGGGATTGGAGACCCAACTGCTTATTCATGTTTCACCACTAGTTATGTCGTCCAAGATTCCGTGATTCAAACTCTCGAATCGAATAAGTTTAATGGCTATGCACCTATTGTTGGCCTCCCTCAAACACGAAAGGCAGTA...

CDS

Download CDS FASTA

1239 bp · TkA01G494620|TK1151|CDS

ATGCAGACACCAACAAATGTGACGATAAAGGGAATTCTTGCTACTCTAATGGCAAGTCTTGATGAGAAAAACAATAAGAAGGTAATCTGTTTAGGGATTGGAGACCCAACTGCTTATTCATGTTTCACCACTAGTTATGTCGTCCAAGATTCCGTGATTCAAACTCTCGAATCGAATAAGTTTAATGGCTATGCACCTATTGTTGGCCTCCCTCAAACACGAAAGGCAGTATCGGAGTACTTATCGAAAGATCTCCCGTA...

Protein

Download Protein FASTA

412 aa · TkA01G494620|TK1151|PROTEIN

MQTPTNVTIKGILATLMASLDEKNNKKVICLGIGDPTAYSCFTTSYVVQDSVIQTLESNKFNGYAPIVGLPQTRKAVSEYLSKDLPYKLSPDDVYITSGCTQAIEVVISILAKPNANILVPKPGFPTYELCAAFKNLEIRHFDLIPEKGWEVDLDAVDALADENTVAIVIINPGNPCGNVYSYQHLKKIAETAKNHRILVVADEVYGHLAFGENPFIPMGVFGSIVPVLTLGSMSKRWLVPGFRVGWLVTTDPNGIFKNA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G494620`
TK1151 ID	TkA01G494620
OH-1004 ID	LXL04_001954
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.000
Protein coverage (%)	TK1151 99.757 / OH-1004 89.716 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G494620

Location Chr01:123790967-123793331 (+)

Description Similar to At5g53970: Probable aminotransferase TAT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53970`	Probable aminotransferase TAT2.	No verified direct reference in this release
`At5g36160`	Transaminase involved in tyrosine breakdown.	Identification and Partial Characterization of an L-Tyrosine Aminotransferase (TAT) from Arabidopsis thaliana.2010 · DOI: 10.1155/2010/549572

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0306401`	Involved in biosynthesis of mugineic acid family phytosiderophores, which are ferric iron chelators produced in graminaceous plants in response to iron deficiency.	Identification and localisation of the rice nicotianamine aminotransferase gene OsNAAT1 expression suggests the site of phytosiderophore synthesis in rice.2008 · DOI: 10.1007/s11103-007-9262-8

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001954 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006572 L-tyrosine catabolic process Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004838 L-tyrosine-2-oxoglutarate transaminase activity Molecular Function

GO:0030170 pyridoxal phosphate binding Molecular Function

GO:0033855 nicotianamine aminotransferase activity Molecular Function

KEGG gene cross-reference

ag:BAA87052

ag:BAA87053

ath:AT5G53970

dosa:Os02g0306401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.647

Rank 1 · TkA01G494620 · TK1151

Nucleus0.177

Rank 2 · TkA01G494620 · TK1151

Mitochondrion0.083

Rank 3 · TkA01G494620 · TK1151

Endoplasmic reticulum0.076

Rank 4 · TkA01G494620 · TK1151

Peroxisome0.071

Rank 5 · TkA01G494620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155Aminotran_1_227-390 aa

PF00266Aminotran_591-205 aa

PF01212Beta_elim_lyase95-203 aa

PF01053Cys_Met_Meta_PP95-206 aa

PF01041DegT_DnrJ_EryC197-203 aa

PF00202Aminotran_3160-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G494620	`PF00155`	Aminotran_1_2	27	390	2.2e-55	189.1
TkA01G494620	`PF00266`	Aminotran_5	91	205	8.6e-06	25.7
TkA01G494620	`PF01212`	Beta_elim_lyase	95	203	0.00039	20.6
TkA01G494620	`PF01053`	Cys_Met_Meta_PP	95	206	0.0022	17.3
TkA01G494620	`PF01041`	DegT_DnrJ_EryC1	97	203	0.019	14.9
TkA01G494620	`PF00202`	Aminotran_3	160	205	0.048	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN30`	Arabidopsis thaliana	sp\|Q9FN30\|TAT2_ARATH Probable aminotransferase TAT2	68.200%	Swiss-Prot	High
`Q9LVY1`	Arabidopsis thaliana	sp\|Q9LVY1\|TAT_ARATH Tyrosine aminotransferase	54.100%	Swiss-Prot	High
`A0A0P0VI36`	Oryza sativa subsp. japonica	sp\|A0A0P0VI36\|NAAT1_ORYSJ Nicotianamine aminotransferase 1	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card