LXL04_001954 | RubberDandelionOmics

Gene overview

LXL04_001954

Reference: OH-1004 Chr: Chr01 Coordinates: 37913778-37915694 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1374 bp · LXL04_001954|LXL04_001954|OH1004|cDNA

ATGTCAAGCCAGACATATACACGTTTAAGAAAAATACAACTGCCTTTCCACCTATATATATTTCACATTCCTATTTCCTTACCCATTCATCTCACACACAGTGTTGGTCGCAAAGACAAGTGTACCCTTATCTCTTCCAAGATGCAAACACCAACAAACGTAaccataaagggcattttgggtaTTTTAATGGCAAGTCTCGATGAGAAAAACAAGAAGAAGGTAATCTCTTTAGGAATGGGAGACCCAACTACTTATTC...

CDS

Download CDS FASTA

1374 bp · LXL04_001954|LXL04_001954|OH1004|CDS

ATGTCAAGCCAGACATATACACGTTTAAGAAAAATACAACTGCCTTTCCACCTATATATATTTCACATTCCTATTTCCTTACCCATTCATCTCACACACAGTGTTGGTCGCAAAGACAAGTGTACCCTTATCTCTTCCAAGATGCAAACACCAACAAACGTAACCATAAAGGGCATTTTGGGTATTTTAATGGCAAGTCTCGATGAGAAAAACAAGAAGAAGGTAATCTCTTTAGGAATGGGAGACCCAACTACTTATTC...

Protein

Download Protein FASTA

457 aa · LXL04_001954|LXL04_001954|OH1004|PROTEIN

MSSQTYTRLRKIQLPFHLYIFHIPISLPIHLTHSVGRKDKCTLISSKMQTPTNVTIKGILGILMASLDEKNKKKVISLGMGDPTTYSCFTTTDLVQDSVIQTLESRKFNGYSPTVGLPQTRKAISEYLSKDLPYKLTADDVYITAGCTQAIEVAISILARPNANILVPKPGFPIYELCAAFRNVEIRHFNLIPENNWEVNLDEVDTLVDHNTVAIVVINPGNPCGNVYSYQHLKKIAESAKKNRVVVIADEVYGHLAFGE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001954`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001954

Location Chr01:37913778-37915694 (-)

Description Similar to At5g53970: Probable aminotransferase TAT2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53970`	Probable aminotransferase TAT2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0306401`	Involved in biosynthesis of mugineic acid family phytosiderophores, which are ferric iron chelators produced in graminaceous plants in response to iron deficiency.	Identification and localisation of the rice nicotianamine aminotransferase gene OsNAAT1 expression suggests the site of phytosiderophore synthesis in rice.2008 · DOI: 10.1007/s11103-007-9262-8

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001954 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006572 L-tyrosine catabolic process Biological Process

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004838 L-tyrosine-2-oxoglutarate transaminase activity Molecular Function

GO:0030170 pyridoxal phosphate binding Molecular Function

GO:0033855 nicotianamine aminotransferase activity Molecular Function

KEGG gene cross-reference

ag:BAA87052

ag:BAA87053

ath:AT5G53970

dosa:Os02g0306401

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.407

Rank 1 · LXL04_001954 · OH-1004

Peroxisome0.154

Rank 2 · LXL04_001954 · OH-1004

Plastid0.130

Rank 3 · LXL04_001954 · OH-1004

Mitochondrion0.126

Rank 4 · LXL04_001954 · OH-1004

Nucleus0.122

Rank 5 · LXL04_001954 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00155.28Aminotran_1_273-439 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001954	`PF00155.28`	Aminotran_1_2	73	439	1.1e-56	193.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN30`	Arabidopsis thaliana	Probable aminotransferase TAT2	69.802%	Swiss-Prot	strong database homology
`A0A0P0VI36`	Oryza sativa subsp. japonica	Nicotianamine aminotransferase 1	53.652%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card