TkA01G494010 | RubberDandelionOmics

Gene overview

TkA01G494010

Reference: TK1151 Chr: Chr01 Coordinates: 123608567-123613239 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · TkA01G494010|TK1151|cDNA

ATGACGACGGAGCTGCCACCGGACATACTATTCTTCAACATACTACCAAGGCTGCCGCCCAAATCTGTATCACGTTTCAAGTGTGTTTCAAAGAAATGGCACTCCTTCCTACGATCTCCCCGTTTTCTCCAAATGCACAAACTCCATCTACTCCATGCAAAAAACACTCAAAATGAGAAGTACATCTTCTTACCTAACACAAGACCATGGGATTTCCGCACCATCGACTGTGAAACACCCGAAGATGGTTTCACTACCAG...

CDS

Download CDS FASTA

1077 bp · TkA01G494010|TK1151|CDS

ATGACGACGGAGCTGCCACCGGACATACTATTCTTCAACATACTACCAAGGCTGCCGCCCAAATCTGTATCACGTTTCAAGTGTGTTTCAAAGAAATGGCACTCCTTCCTACGATCTCCCCGTTTTCTCCAAATGCACAAACTCCATCTACTCCATGCAAAAAACACTCAAAATGAGAAGTACATCTTCTTACCTAACACAAGACCATGGGATTTCCGCACCATCGACTGTGAAACACCCGAAGATGGTTTCACTACCAG...

Protein

Download Protein FASTA

358 aa · TkA01G494010|TK1151|PROTEIN

MTTELPPDILFFNILPRLPPKSVSRFKCVSKKWHSFLRSPRFLQMHKLHLLHAKNTQNEKYIFLPNTRPWDFRTIDCETPEDGFTTSRPFPFKVGLRQDISILSSVNGLVCVGIINYSSLDDKISHIILWNPVTNDQKMLPKYRSRRCYMTALHKYELYYSFSENDYKLIWISHRRNVRIYSLKSNKWRKIKSKSKLSSSDSVSYDIMSSVMSNEKFHFLRKFFVFEGGDEKVRLGNDERTRDFMGFLDLKGHAYFCVAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G494010`
TK1151 ID	TkA01G494010
OH-1004 ID	LXL04_001963
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.800
Protein coverage (%)	TK1151 99.721 / OH-1004 98.118 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G494010`
Location	Chr01:123608567-123613239 (-)
Description	Similar to At1g47790: Putative F-box protein At1g47790
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001963` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0048364 root development Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component
KEGG gene cross-reference	ath:AT1G11620 ath:AT1G12870 ath:AT1G47790 ath:AT1G53370 ath:AT1G60370 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.483

Rank 1 · TkA01G494010 · TK1151

Cytoplasm0.472

Rank 2 · TkA01G494010 · TK1151

Cell membrane0.101

Rank 3 · TkA01G494010 · TK1151

Endoplasmic reticulum0.079

Rank 4 · TkA01G494010 · TK1151

Mitochondrion0.043

Rank 5 · TkA01G494010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937F-box-like4-40 aa

PF00646F-box5-43 aa

PF01344Kelch_121-35 aa

PF27304UU051_N52-67 aa

PF08268FBA_3100-199 aa

PF03478Beta-prop_KIB1-4102-221 aa

PF07734FBA_1121-200 aa

PF01344Kelch_1127-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G494010	`PF12937`	F-box-like	4	40	0.00018	21.9
TkA01G494010	`PF00646`	F-box	5	43	3.9e-06	27.3
TkA01G494010	`PF01344`	Kelch_1	21	35	0.034	14.4
TkA01G494010	`PF27304`	UU051_N	52	67	0.089	13.5
TkA01G494010	`PF08268`	FBA_3	100	199	9.6e-07	28.8
TkA01G494010	`PF03478`	Beta-prop_KIB1-4	102	221	2.4e-05	24.7
TkA01G494010	`PF07734`	FBA_1	121	200	1.3e-05	25.1
TkA01G494010	`PF01344`	Kelch_1	127	141	0.034	14.4
TkA01G494010	`PF24814`	WD40_Prp19	161	212	0.012	15.4
TkA01G494010	`PF27304`	UU051_N	174	225	0.089	13.5
TkA01G494010	`PF01344`	Kelch_1	176	193	0.034	14.4
TkA01G494010	`PF00646`	F-box	185	192	3.9e-06	27.3
TkA01G494010	`PF24814`	WD40_Prp19	328	345	0.012	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card