TkA01G474190 | RubberDandelionOmics

Gene overview

TkA01G474190

Reference: TK1151 Chr: Chr01 Coordinates: 118665571-118672768 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5056 bp · TkA01G474190|TK1151|cDNA

AAAAAATCACATATGTGTAATTAATGTGAAAAAGACAAAAACATGTAACAAAAAAAACTGTAAACCAATCATATTCGGACATTATACACATCATATTTTACTATCAGCTACCTGTTTACCTTCTTCCTCCTCTCACAAATCTACAAAACCTAATCATTTCTCTTTTTTTATTTTATGTGGATACAGTCGCCGGAGCTGTGATTTTCTCTCTCTGTCTCTCTGTCTCGACTAAAATCTATCCACCTGCCTTTGAACATTAA...

CDS

Download CDS FASTA

1371 bp · TkA01G474190|TK1151|CDS

ATGAGGCTCGGGGATCCGGATTGCGGAACGATGACTTCAGAAGATGACCAACGAGATTGGATCAGAGAGGTCCCCAAAGTCAGCAATGCCTATCTGCAGAAATTCAGACTCTACGAGACTCGCTCTAACTTTTATATGATTGGACGGAGTAAAGATAGATCAACTTGGAGAGTTTTAAAGATTGATAGGTCAGAACCTGCCGAGCTAAATATCACAGAAGATCCCACAACATACACAGAAGTTGAATGCTTGGAACTGCT...

Protein

Download Protein FASTA

456 aa · TkA01G474190|TK1151|PROTEIN

MRLGDPDCGTMTSEDDQRDWIREVPKVSNAYLQKFRLYETRSNFYMIGRSKDRSTWRVLKIDRSEPAELNITEDPTTYTEVECLELLKRIHDGNKSTGGLRFVTTCYGIVGFIKFLGPYYMLLITKRRKIGVICGHAVYAITKSEILPIPNSSVQPSVAYSKNENRYKKLLCSVDLTKDFYYSYSYRVMHSFQKNLSTHDKGQFLNETMFVWNEFLTSTIHNQLKNNLWTVALVYGHFKQVKLSIAEKDFKLTLIARRSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G474190`
TK1151 ID	TkA01G474190
OH-1004 ID	LXL04_002219
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.781 / OH-1004 37.885 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G474190

Location Chr01:118665571-118672768 (+)

Description Similar to SAC2: Phosphoinositide phosphatase SAC2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14205`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At3g43220`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At5g20840`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At1g22620`	Phosphoinositide phosphatase which catalyzes the hydrolysis of phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2).	Mutation of SAC1, an Arabidopsis SAC domain phosphoinositide phosphatase, causes alterations in cell morphogenesis, cell wall synthesis, and actin organization.2005 · DOI: 10.1105/tpc.105.031377
`At1g17340`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002219 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007010 cytoskeleton organization Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0036092 phosphatidylinositol-3-phosphate biosynthetic process Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004438 phosphatidylinositol-3-phosphate phosphatase activity Molecular Function

GO:0043812 phosphatidylinositol-4-phosphate phosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17340

ath:AT1G22620

ath:AT3G14205

ath:AT3G43220

ath:AT5G20840

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.341

Rank 1 · TkA01G474190 · TK1151

Cytoplasm0.340

Rank 2 · TkA01G474190 · TK1151

Mitochondrion0.199

Rank 3 · TkA01G474190 · TK1151

Cell membrane0.118

Rank 4 · TkA01G474190 · TK1151

Endoplasmic reticulum0.091

Rank 5 · TkA01G474190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13280WYL36-63 aa

PF28939RYamide37-62 aa

PF02383Syja_N107-404 aa

PF28939RYamide230-284 aa

PF21084WHD_DUF4423_like414-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G474190	`PF13280`	WYL	36	63	0.077	13.7
TkA01G474190	`PF28939`	RYamide	37	62	0.092	13.3
TkA01G474190	`PF02383`	Syja_N	107	404	8.6e-83	278.9
TkA01G474190	`PF28939`	RYamide	230	284	0.092	13.3
TkA01G474190	`PF21084`	WHD_DUF4423_like	414	440	0.19	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94A27`	Arabidopsis thaliana	sp\|Q94A27\|SAC2_ARATH Phosphoinositide phosphatase SAC2	69.400%	Swiss-Prot	High
`Q7XZU2`	Arabidopsis thaliana	sp\|Q7XZU2\|SAC3_ARATH Phosphoinositide phosphatase SAC3	69.400%	Swiss-Prot	High
`Q7XZU1`	Arabidopsis thaliana	sp\|Q7XZU1\|SAC4_ARATH Phosphoinositide phosphatase SAC4	68.600%	Swiss-Prot	High
`Q7XZU3`	Arabidopsis thaliana	sp\|Q7XZU3\|SAC1_ARATH Phosphatidylinositol-3-phosphatase SAC1	57.900%	Swiss-Prot	High
`Q8RW97`	Arabidopsis thaliana	sp\|Q8RW97\|SAC5_ARATH Phosphoinositide phosphatase SAC5	57.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card