TkA01G463270 | RubberDandelionOmics

Gene overview

TkA01G463270

Reference: TK1151 Chr: Chr01 Coordinates: 116083491-116086435 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

903 bp · TkA01G463270|TK1151|cDNA

ATGTTTGAATTTACAAGGGTAAACACTAAGGACGATCACGAAGGGGACATCGAACAGGGAAATCTCTATCCTGGGATTAGCCATGGAGAAAATCAAATTCGTTGGGGCTTCATCCGTAAGGTTTACGGCATTCTCGCCGCCCAGATGGTTTTGACCACAGCGGTCTCTTGCCTCACTGTCCTATACGCACATATCAACGATCTTCTTCGTGGGAATTCCGGCCTCTTGCCCTTCATCCACTTCTTGGTTATGAGGGACTT...

CDS

Download CDS FASTA

903 bp · TkA01G463270|TK1151|CDS

ATGTTTGAATTTACAAGGGTAAACACTAAGGACGATCACGAAGGGGACATCGAACAGGGAAATCTCTATCCTGGGATTAGCCATGGAGAAAATCAAATTCGTTGGGGCTTCATCCGTAAGGTTTACGGCATTCTCGCCGCCCAGATGGTTTTGACCACAGCGGTCTCTTGCCTCACTGTCCTATACGCACATATCAACGATCTTCTTCGTGGGAATTCCGGCCTCTTGCCCTTCATCCACTTCTTGGTTATGAGGGACTT...

Protein

Download Protein FASTA

300 aa · TkA01G463270|TK1151|PROTEIN

MFEFTRVNTKDDHEGDIEQGNLYPGISHGENQIRWGFIRKVYGILAAQMVLTTAVSCLTVLYAHINDLLRGNSGLLPFIHFLVMRDLKLFTLRGTDDAEVEAQRGRWKGEERDSYWRSMQKYVGADITSMVTLQVLIFEPMKMLQKMAELMEYAHLLEQADDCEDPYMRLVCRASWFISVYYALQRTWKPFNPILGETYEMINHNGITFIAEQVVTSKVKTKFLGNTNDVYPLGRDGVILELVPPPTKVNNLIFGRTWID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G463270`
TK1151 ID	TkA01G463270
OH-1004 ID	LXL04_036274
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G463270

Location Chr01:116083491-116086435 (-)

Description Similar to ORP3C: Oxysterol-binding protein-related protein 3C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59420`	May be involved in the transport of sterols.	No verified direct reference in this release
`At5g02100`	Oxysterol-binding protein that may be involved in the transport of sterols between the ER and the Golgi.	The targeting of the oxysterol-binding protein ORP3a to the endoplasmic reticulum relies on the plant VAP33 homolog PVA12.2009 · DOI: 10.1111/j.1365-313x.2009.03815.x
`At3g09300`	May be involved in the transport of sterols.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036274 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0015914 phospholipid transport Biological Process

GO:0050830 defense response to Gram-positive bacterium Biological Process

GO:0120009 intermembrane lipid transfer Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G09300

ath:AT5G02100

ath:AT5G59420

ddi:DDB_G0283709

ddi:DDB_G0288817

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.564

Rank 1 · TkA01G463270 · TK1151

Golgi apparatus0.188

Rank 2 · TkA01G463270 · TK1151

Cytoplasm0.154

Rank 3 · TkA01G463270 · TK1151

Nucleus0.121

Rank 4 · TkA01G463270 · TK1151

Cell membrane0.119

Rank 5 · TkA01G463270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01027Bax1-I34-79 aa

PF01237Oxysterol_BP114-215 aa

PF01237Oxysterol_BP216-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G463270	`PF01027`	Bax1-I	34	79	0.00078	20.1
TkA01G463270	`PF01237`	Oxysterol_BP	114	215	2.8e-36	125.9
TkA01G463270	`PF01237`	Oxysterol_BP	216	278	2.8e-36	125.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y40`	Arabidopsis thaliana	sp\|Q93Y40\|ORP3C_ARATH Oxysterol-binding protein-related protein 3C	66.800%	Swiss-Prot	Medium
`Q9LZM1`	Arabidopsis thaliana	sp\|Q9LZM1\|ORP3A_ARATH Oxysterol-binding protein-related protein 3A	67.600%	Swiss-Prot	Medium
`Q9SR33`	Arabidopsis thaliana	sp\|Q9SR33\|ORP3B_ARATH Oxysterol-binding protein-related protein 3B	59.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card