TkA01G447450 | RubberDandelionOmics

Gene overview

TkA01G447450

Reference: TK1151 Chr: Chr01 Coordinates: 112026631-112028756 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1956 bp · TkA01G447450|TK1151|cDNA

ATGCCGGAAATCAATCGTCTTCCTTCTCTAAAAGCTTTCTATGCCGGCGGCAATTTGTTTTCCGGCGTCATACCTTCAGACTTTTTCCAGACCTTGGGGTCCTTGAAGAAGCTTTGGCTGCAAAACAATCACTTTTCTGGTCAGATTCCGATATCGGTTGGCCAGTTACCAAATCTAAAGGAACTCCATTTAGAATACAATCAATTTTCAGGACCCATTCCCGAATTTTCAGACCCGGATGTCCTAATCAACATCGATCT...

CDS

Download CDS FASTA

1644 bp · TkA01G447450|TK1151|CDS

ATGCCGGAAATCAATCGTCTTCCTTCTCTAAAAGCTTTCTATGCCGGCGGCAATTTGTTTTCCGGCGTCATACCTTCAGACTTTTTCCAGACCTTGGGGTCCTTGAAGAAGCTTTGGCTGCAAAACAATCACTTTTCTGGTCAGATTCCGATATCGGTTGGCCAGTTACCAAATCTAAAGGAACTCCATTTAGAATACAATCAATTTTCAGGACCCATTCCCGAATTTTCAGACCCGGATGTCCTAATCAACATCGATCT...

Protein

Download Protein FASTA

547 aa · TkA01G447450|TK1151|PROTEIN

MPEINRLPSLKAFYAGGNLFSGVIPSDFFQTLGSLKKLWLQNNHFSGQIPISVGQLPNLKELHLEYNQFSGPIPEFSDPDVLINIDLSDNRLQGEIPKSLQKFDSQAFDNNADLCGGPLKECTPTQREEEDSTYRKSAIPWIILIVIILLLTLMILARVKYAGEEYRPNLGKKRLDEFVVNIPPAINRSTSSGKKPQTNTETSDSITTTTATTNDNINVDPIANVQEKKDATPTRTAKKVIPQLAVQPAAGNDLVMVNEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G447450`
TK1151 ID	TkA01G447450
OH-1004 ID	LXL04_002303
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.700
Protein coverage (%)	TK1151 100.000 / OH-1004 83.454 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G447450

Location Chr01:112026631-112028756 (-)

Description Similar to PRK6: Pollen receptor-like kinase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g42880`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	No verified direct reference in this release
`At5g20690`	Key receptor for sensing species-specific attractants in cooperation with other pollen receptor-like kinases.	Tip-localized receptors control pollen tube growth and LURE sensing in Arabidopsis.2016 · DOI: 10.1038/nature17413 Structural basis for receptor recognition of pollen tube attraction peptides.2017 · DOI: 10.1038/s41467-017-01323-8
`At2g07040`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	A distinct mechanism regulating a pollen-specific guanine nucleotide exchange factor for the small GTPase Rop in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0705874104 AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103 The juxtamembrane and carboxy-terminal domains of Arabidopsis PRK2 are critical for ROP-induced growth in pollen tubes.2013 · DOI: 10.1093/jxb/ert323
`At5g35390`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103
`At4g31250`	Probable LRR receptor-like serine/threonine-protein kinase At4g31250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002303 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010183 pollen tube guidance Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0045177 apical part of cell Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G42880

ath:AT4G31250

ath:AT5G20690

ath:AT5G35390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.884

Rank 1 · TkA01G447450 · TK1151

Cytoplasm0.087

Rank 2 · TkA01G447450 · TK1151

Endoplasmic reticulum0.066

Rank 3 · TkA01G447450 · TK1151

Nucleus0.058

Rank 4 · TkA01G447450 · TK1151

Golgi apparatus0.019

Rank 5 · TkA01G447450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799LRR_44-18 aa

PF25019LRR_R13L1-DRL218-65 aa

PF00560LRR_19-29 aa

PF13855LRR_823-69 aa

PF00560LRR_134-56 aa

PF12799LRR_434-71 aa

PF07723LRR_234-47 aa

PF26019HTH_TIMELESS57-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G447450	`PF12799`	LRR_4	4	18	2.1e-07	31.7
TkA01G447450	`PF25019`	LRR_R13L1-DRL21	8	65	0.099	13.3
TkA01G447450	`PF00560`	LRR_1	9	29	1.4e-12	45.8
TkA01G447450	`PF13855`	LRR_8	23	69	5.4e-07	30.0
TkA01G447450	`PF00560`	LRR_1	34	56	1.4e-12	45.8
TkA01G447450	`PF12799`	LRR_4	34	71	2.1e-07	31.7
TkA01G447450	`PF07723`	LRR_2	34	47	0.037	15.4
TkA01G447450	`PF26019`	HTH_TIMELESS	57	85	0.0044	17.9
TkA01G447450	`PF00560`	LRR_1	58	75	1.4e-12	45.8
TkA01G447450	`PF07723`	LRR_2	58	71	0.037	15.4
TkA01G447450	`PF13855`	LRR_8	76	102	5.4e-07	30.0
TkA01G447450	`PF00560`	LRR_1	82	102	1.4e-12	45.8
TkA01G447450	`PF12799`	LRR_4	82	98	2.1e-07	31.7
TkA01G447450	`PF00895`	ATP-synt_8	139	175	0.12	13.5
TkA01G447450	`PF07723`	LRR_2	154	165	0.037	15.4
TkA01G447450	`PF02443`	Circo_capsid	174	241	0.085	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1L7`	Arabidopsis thaliana	sp\|Q9M1L7\|PRK3_ARATH Pollen receptor-like kinase 3	47.500%	Swiss-Prot	Medium
`Q3E991`	Arabidopsis thaliana	sp\|Q3E991\|PRK6_ARATH Pollen receptor-like kinase 6	65.200%	Swiss-Prot	Medium
`Q84JQ4`	Arabidopsis thaliana	sp\|Q84JQ4\|PRK2_ARATH Pollen receptor-like kinase 2	33.300%	Swiss-Prot	Medium
`C0LGU0`	Arabidopsis thaliana	sp\|C0LGU0\|PRK1_ARATH Pollen receptor-like kinase 1	33.800%	Swiss-Prot	Medium
`C0LGR9`	Arabidopsis thaliana	sp\|C0LGR9\|Y4312_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g31250	35.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card