TkA01G446730 | RubberDandelionOmics

Gene overview

TkA01G446730

Reference: TK1151 Chr: Chr01 Coordinates: 111855792-111859248 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2526 bp · TkA01G446730|TK1151|cDNA

TTTTATCCGTCCATCCATTTACCCGGTGTTTGGCCCGTCCTCATTTTCTCGCGGGTCCAGTTTTGTCTCAGTTATCTTCTTTCTGGATTATTCTTCGGTTCTGATTTTTCCACCGCGTTCTTTATCACCATCTTCTTGCTCTTTCTTCGGCGTCCGTCTTCTCTGCGACTCGCTCTGCTTTCCGTCTTCTCTGCTACAGCTAATCGGTGCATGACCTAATCTTTGTATGCCGCCTCCAATTCAAGGTGATTTCCCGATTT...

CDS

Download CDS FASTA

1080 bp · TkA01G446730|TK1151|CDS

ATGTTAAAATGGTTGAGTTTAATGTTGCAACAAAATCAAGAATTTGAGCAAGATGAAACGAGGAGTTTCAGGCTCCAGGTAGGCAGCTCGATTGCCAGCTCACCGCCAGGTGTCTGGCCCCAATTCGGTAGTCCAATTGAAAACCACGGTACTTTACAAAACCTAAGCAACAGTTTACCTGGATTGGCTTCGATTTTGCATCCACAACCATTAAGAAACATAGCGCCAATTGGTAAAGACCATGGAAGAAACAACAACAG...

Protein

Download Protein FASTA

359 aa · TkA01G446730|TK1151|PROTEIN

MLKWLSLMLQQNQEFEQDETRSFRLQVGSSIASSPPGVWPQFGSPIENHGTLQNLSNSLPGLASILHPQPLRNIAPIGKDHGRNNNSLFDFDQMLSNGNNSNFQHSRSLQGTGSSFGTSGIETLSGAQFLWGSPGPTTHGFSIPQGQNGHFHQHVGSAPLEQGFGQFHDFVGHSSSFGGQMDHGFLNSHGSSRVNPVFLGNGHYPGIGIGAVNLESRNRRMEYNGNQMDNKKQLFQLDIEKIRSGEDTRTTLMIKNIPNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G446730`
TK1151 ID	TkA01G446730
OH-1004 ID	LXL04_014602
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.300
Protein coverage (%)	TK1151 88.579 / OH-1004 95.808 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G446730

Location Chr01:111855792-111859248 (+)

Description Similar to ML2: Protein MEI2-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29400`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release
`At4g18120`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0719800`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os02g0319100`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os02g0517531`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014602 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0045836 positive regulation of meiotic nuclear division Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G29400

dosa:Os02g0319100

dosa:Os02g0517531

dosa:Os02g0719800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.526

Rank 1 · TkA01G446730 · TK1151

Cytoplasm0.492

Rank 2 · TkA01G446730 · TK1151

Cell membrane0.065

Rank 3 · TkA01G446730 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA01G446730 · TK1151

Plastid0.039

Rank 5 · TkA01G446730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04059RRM_2249-345 aa

PF03467Smg4_UPF3249-337 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G446730	`PF04059`	RRM_2	249	345	1.7e-51	173.1
TkA01G446730	`PF03467`	Smg4_UPF3	249	337	0.1	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWF5`	Arabidopsis thaliana	sp\|Q8VWF5\|AML5_ARATH Protein MEI2-like 5	44.600%	Swiss-Prot	Medium
`Q9SVV9`	Arabidopsis thaliana	sp\|Q9SVV9\|AML3_ARATH Protein MEI2-like 3	44.800%	Swiss-Prot	Medium
`Q6ZI17`	Oryza sativa subsp. japonica	sp\|Q6ZI17\|OML2_ORYSJ Protein MEI2-like 2	46.700%	Swiss-Prot	Medium
`Q6EQX3`	Oryza sativa subsp. japonica	sp\|Q6EQX3\|OML5_ORYSJ Protein MEI2-like 5	44.500%	Swiss-Prot	Medium
`Q64M78`	Oryza sativa subsp. japonica	sp\|Q64M78\|OML4_ORYSJ Protein MEI2-like 4	78.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card