LXL04_014602 | RubberDandelionOmics

Gene overview

LXL04_014602

Reference: OH-1004 Chr: Chr03 Coordinates: 53521958-53523235 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1118 bp · LXL04_014602|LXL04_014602|OH1004|cDNA

ATGTTAAAATGGTTGAGTTTAATGTTGCAACAAAATCAAGAATTTGAGCAGGATGAAACGAGGAGTATCAGGCTCCAGGTAGGCAGCTCGATTGCCAGCTCCCCGCTAGGTGTCTGGCCCCAATTCGGTAGTCCAATTGAAAACCACGGCACTTTACAAAACCTAAGCAATAGTTTACCTGGATTGGCTTCGATTTTGCATCCACAACCATTAAGAAACATAGCGCCAATTGGTAAAGACCATGGAAGAAACAACAACAG...

CDS

Download CDS FASTA

1005 bp · LXL04_014602|LXL04_014602|OH1004|CDS

ATGTTAAAATGGTTGAGTTTAATGTTGCAACAAAATCAAGAATTTGAGCAGGATGAAACGAGGAGTATCAGGCTCCAGGTAGGCAGCTCGATTGCCAGCTCCCCGCTAGGTGTCTGGCCCCAATTCGGTAGTCCAATTGAAAACCACGGCACTTTACAAAACCTAAGCAATAGTTTACCTGGATTGGCTTCGATTTTGCATCCACAACCATTAAGAAACATAGCGCCAATTGGTAAAGACCATGGAAGAAACAACAACAG...

Protein

Download Protein FASTA

334 aa · LXL04_014602|LXL04_014602|OH1004|PROTEIN

MLKWLSLMLQQNQEFEQDETRSIRLQVGSSIASSPLGVWPQFGSPIENHGTLQNLSNSLPGLASILHPQPLRNIAPIGKDHGRNNNSLFDFDQRLSNGNNSNFQHSRSSQGTGSSFGTSGIETLSGAQFLWGSPGPTTHGFSIPQGQNGHFHQHVGSAPLEQGFGQFHDFVGHSSSFGGQMDHGFLNSHGSSRLNPVFLGNGHYLGIGIGAMNLESRNRRMEYNGNQMDNKKQLFQLDIEKIRSREDTRKTLMIKNIPNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014602`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014602

Location Chr03:53521958-53523235 (-)

Description Similar to ML2: Protein MEI2-like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29400`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release
`At4g18120`	Probable RNA-binding protein that plays a role in meiosis and vegetative growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0719800`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os02g0319100`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release
`Os02g0517531`	Probable RNA-binding protein that may play a role in growth regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014602 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0045836 positive regulation of meiotic nuclear division Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G29400

dosa:Os02g0319100

dosa:Os02g0517531

dosa:Os02g0719800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.533

Rank 1 · LXL04_014602 · OH-1004

Nucleus0.517

Rank 2 · LXL04_014602 · OH-1004

Cell membrane0.057

Rank 3 · LXL04_014602 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_014602 · OH-1004

Peroxisome0.029

Rank 5 · LXL04_014602 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04059.19RRM_2249-320 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014602	`PF04059.19`	RRM_2	249	320	1.9e-32	112.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWF5`	Arabidopsis thaliana	Protein MEI2-like 5	40.250%	Swiss-Prot	moderate database homology
`Q9SVV9`	Arabidopsis thaliana	Protein MEI2-like 3	38.504%	Swiss-Prot	moderate database homology
`Q6ZI17`	Oryza sativa subsp. japonica	Protein MEI2-like 2	40.898%	Swiss-Prot	moderate database homology
`Q6EQX3`	Oryza sativa subsp. japonica	Protein MEI2-like 5	37.766%	Swiss-Prot	moderate database homology
`Q64M78`	Oryza sativa subsp. japonica	Protein MEI2-like 4	69.231%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card