TkA01G442830 | RubberDandelionOmics

Gene overview

TkA01G442830

Reference: TK1151 Chr: Chr01 Coordinates: 110748524-110750975 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · TkA01G442830|TK1151|cDNA

ATGGCTTCAATGGCAACATCTTATTCACAATTTGAGCTTGATAGAAATCAAAGTCGGACTTATAAACTTGGAGCAATTACCGACATTTATGAGAAATTTTCTAGTTCCGCCCCTGAAGCATCGATTGCAGGATCAAGTATATCAGAAAAATACGGACTGGATGCAACAAATGTTGGTGATGAATATGGCTTTGCTCCTAACATTCTGGAAAATAAAGAGGGTCTTGAATTGCTTAAGACAGCAATTGCTAAAGCTGGATA...

CDS

Download CDS FASTA

639 bp · TkA01G442830|TK1151|CDS

ATGGCTTCAATGGCAACATCTTATTCACAATTTGAGCTTGATAGAAATCAAAGTCGGACTTATAAACTTGGAGCAATTACCGACATTTATGAGAAATTTTCTAGTTCCGCCCCTGAAGCATCGATTGCAGGATCAAGTATATCAGAAAAATACGGACTGGATGCAACAAATGTTGGTGATGAATATGGCTTTGCTCCTAACATTCTGGAAAATAAAGAGGGTCTTGAATTGCTTAAGACAGCAATTGCTAAAGCTGGATA...

Protein

Download Protein FASTA

212 aa · TkA01G442830|TK1151|PROTEIN

MASMATSYSQFELDRNQSRTYKLGAITDIYEKFSSSAPEASIAGSSISEKYGLDATNVGDEYGFAPNILENKEGLELLKTAIAKAGYTGKVVIGGGGKRNRGEPVGYGVGTRGGFACAAIGVSLNSKDEEGRKALHVASANGNVDIVNYLISNNVEHMKFVPFSHVRTPVDEAAIDGKMDVIDAINTAVAQTELTRTNIVQFWLVVFDFRQC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G442830`
TK1151 ID	TkA01G442830
OH-1004 ID	LXL04_027739
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.500
Protein coverage (%)	TK1151 75.472 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G442830`
Location	Chr01:110748524-110750975 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027739` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006096 glycolytic process Biological Process GO:0000015 phosphopyruvate hydratase complex Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0004634 phosphopyruvate hydratase activity Molecular Function
KEGG gene cross-reference	dosa:Os10g0167300 rcu:8288376 zma:542316 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · TkA01G442830 · TK1151

Nucleus0.411

Rank 2 · TkA01G442830 · TK1151

Cell membrane0.102

Rank 3 · TkA01G442830 · TK1151

Mitochondrion0.077

Rank 4 · TkA01G442830 · TK1151

Endoplasmic reticulum0.060

Rank 5 · TkA01G442830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00113Enolase_C14-42 aa

PF00113Enolase_C45-94 aa

PF18753Nmad261-103 aa

PF13637Ank_464-82 aa

PF13857Ank_570-76 aa

PF12796Ank_2121-182 aa

PF13637Ank_4121-151 aa

PF13857Ank_5121-155 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G442830	`PF00113`	Enolase_C	14	42	1.8e-14	54.5
TkA01G442830	`PF00113`	Enolase_C	45	94	1.8e-14	54.5
TkA01G442830	`PF18753`	Nmad2	61	103	0.26	11.6
TkA01G442830	`PF13637`	Ank_4	64	82	3.2e-06	28.0
TkA01G442830	`PF13857`	Ank_5	70	76	5.1e-06	27.5
TkA01G442830	`PF12796`	Ank_2	121	182	2.6e-06	28.6
TkA01G442830	`PF13637`	Ank_4	121	151	3.2e-06	28.0
TkA01G442830	`PF13857`	Ank_5	121	155	5.1e-06	27.5
TkA01G442830	`PF13606`	Ank_3	130	154	4.3e-05	24.3
TkA01G442830	`PF00023`	Ank	131	153	0.00018	22.3
TkA01G442830	`PF13606`	Ank_3	167	185	4.3e-05	24.3
TkA01G442830	`PF00023`	Ank	167	183	0.00018	22.3
TkA01G442830	`PF13637`	Ank_4	171	184	3.2e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card