LXL04_027739 | RubberDandelionOmics

Gene overview

LXL04_027739

Reference: OH-1004 Chr: Chr06 Coordinates: 22858405-22860612 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

527 bp · LXL04_027739|LXL04_027739|OH1004|cDNA

AATATCTAAATGGAAAAGTACAAGCATCGATTGCAGGATCAAGTATATCAGAAAAATACGGTCTGGATGCAACAAATGTTGGTGATGAATGTGGCTTTGCTCCTAACATTCTGGAAAATAAAGAGGGTCTTGAATTGCTTAAGACAGCAATTGCTAAAGCTGGATACACCGGAAAGGTTGTCATTGGGGGCGGAGGCAAACGGAACAGAGGAGAACCCGTTGGCTACGGTGTCGGAACACCTGCTATTGGGGTTTCTCTT...

CDS

Download CDS FASTA

465 bp · LXL04_027739|LXL04_027739|OH1004|CDS

CTGGATGCAACAAATGTTGGTGATGAATGTGGCTTTGCTCCTAACATTCTGGAAAATAAAGAGGGTCTTGAATTGCTTAAGACAGCAATTGCTAAAGCTGGATACACCGGAAAGGTTGTCATTGGGGGCGGAGGCAAACGGAACAGAGGAGAACCCGTTGGCTACGGTGTCGGAACACCTGCTATTGGGGTTTCTCTTAATTCCAAGGATGAAGAAGGGCGGAAAGCACTTCATATGGCTTCAGCAAATGGAAACGTTGA...

Protein

Download Protein FASTA

154 aa · LXL04_027739|LXL04_027739|OH1004|PROTEIN

MDATNVGDECGFAPNILENKEGLELLKTAIAKAGYTGKVVIGGGGKRNRGEPVGYGVGTPAIGVSLNSKDEEGRKALHMASANGNVDIVNYLISNNVEHMKFVPFSHVRTPVDEAAIGGKMDVIDAINTTVAQTELTRTNIVQFWLVVFDFRQC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027739`
TK1151 ID	TkA01G442830
OH-1004 ID	LXL04_027739
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.500
Protein coverage (%)	TK1151 75.472 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027739

Location Chr06:22858405-22860612 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0167300`	Enolase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027739 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006096 glycolytic process Biological Process

GO:0000015 phosphopyruvate hydratase complex Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0004634 phosphopyruvate hydratase activity Molecular Function

KEGG gene cross-reference

dosa:Os10g0167300

rcu:8288376

zma:542316

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.473

Rank 1 · LXL04_027739 · OH-1004

Nucleus0.399

Rank 2 · LXL04_027739 · OH-1004

Extracellular0.085

Rank 3 · LXL04_027739 · OH-1004

Cell membrane0.079

Rank 4 · LXL04_027739 · OH-1004

Mitochondrion0.076

Rank 5 · LXL04_027739 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00113.29Enolase_C2-42 aa

PF13637.13Ank_463-93 aa

PF12796.14Ank_263-124 aa

PF13857.13Ank_564-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027739	`PF00113.29`	Enolase_C	2	42	6.4e-12	46.1
LXL04_027739	`PF13637.13`	Ank_4	63	93	3.7e-07	31.0
LXL04_027739	`PF12796.14`	Ank_2	63	124	1.7e-06	29.2
LXL04_027739	`PF13857.13`	Ank_5	64	97	3.7e-06	27.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42971`	Oryza sativa subsp. japonica	Enolase	92.683%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card