TkA01G436000 | RubberDandelionOmics

Gene overview

TkA01G436000

Reference: TK1151 Chr: Chr01 Coordinates: 108931273-108934830 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2446 bp · TkA01G436000|TK1151|cDNA

AAACGACACTACATTTTCTCCTTTTCCTTTTAACAATATTCCTTCACCGATCTTCCCCTCGTGATTTATCACTCTCTCTCTTTCTCTGACCAGACATTCTTCCTCTCTAAAAAAACCTCCATCGCTAATGGCCGCCTGTCGCCGGAAACCTCCAAAATAGCCACCACAACACCACCTACTCATCTCCCTTTACTCAACTACAAACAAAATCACAGTGCATTTCTACCCATGGCTCTTTATTCTGTTTTCCTCTTTTCCCT...

CDS

Download CDS FASTA

1968 bp · TkA01G436000|TK1151|CDS

ATGGCTCTTTATTCTGTTTTCCTCTTTTCCCTTTTTCTCCTGAATCATCAAGTCGCATCCGAGCCGACTCAGGACAAACAAGCGCTCCTTTCATTTATCTCCCAAGTTCCTCACGCTTCTCGTATCTCATGGAACTCGTCCGAATCCGCTTGCTCTTGGGTTGGCGTTACCTGCGACCCAACTAACTCATCCGTCATCTATCTCCGCCTCCCCGGCGTCGACCTCGTCGGACAAATACCACCGAAAACAATCGGAAGTTT...

Protein

Download Protein FASTA

655 aa · TkA01G436000|TK1151|PROTEIN

MALYSVFLFSLFLLNHQVASEPTQDKQALLSFISQVPHASRISWNSSESACSWVGVTCDPTNSSVIYLRLPGVDLVGQIPPKTIGSLSQLRVLSLHSNGLTGGLPSDFSNLSFLRSVYLQDNKFSGEFPPSLSELTRLTRLDLSDNNFSGTLPFAINNLTQLTGLFLENNSFSGQLPSISPASLVALNLSNNNLNGSIPKSLAAFPVSAFSGNINLCGDPLPACDNSFFPSPAPSPSSLEPPALQKKSKKKLSTGAIVAI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G436000`
TK1151 ID	TkA01G436000
OH-1004 ID	LXL04_012114
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.800
Protein coverage (%)	TK1151 95.878 / OH-1004 88.743 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G436000

Location Chr01:108931273-108934830 (-)

Description Similar to At5g58300: Probable inactive receptor kinase At5g58300

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release
`At5g58300`	Probable inactive receptor kinase At5g58300.	No verified direct reference in this release
`At3g08680`	Probable inactive receptor kinase At3g08680.	No verified direct reference in this release
`At4g23740`	Probable inactive receptor kinase At4g23740.	No verified direct reference in this release
`At5g05160`	Probable leucine-rich repeat receptor-like protein kinase.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012114 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:2000605 positive regulation of secondary growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016328 lateral plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G26730

ath:AT3G08680

ath:AT4G23740

ath:AT5G05160

ath:AT5G58300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.887

Rank 1 · TkA01G436000 · TK1151

Cytoplasm0.074

Rank 2 · TkA01G436000 · TK1151

Endoplasmic reticulum0.069

Rank 3 · TkA01G436000 · TK1151

Nucleus0.056

Rank 4 · TkA01G436000 · TK1151

Golgi apparatus0.019

Rank 5 · TkA01G436000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_223-59 aa

PF23598LRR_1470-166 aa

PF13855LRR_878-124 aa

PF00560LRR_189-111 aa

PF12799LRR_489-123 aa

PF13516LRR_690-102 aa

PF24141LRR_ComC107-201 aa

PF13516LRR_6112-127 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G436000	`PF08263`	LRRNT_2	23	59	2.5e-10	41.1
TkA01G436000	`PF23598`	LRR_14	70	166	6e-09	35.8
TkA01G436000	`PF13855`	LRR_8	78	124	9.5e-10	38.8
TkA01G436000	`PF00560`	LRR_1	89	111	2.7e-15	53.9
TkA01G436000	`PF12799`	LRR_4	89	123	3.7e-09	37.3
TkA01G436000	`PF13516`	LRR_6	90	102	0.026	15.3
TkA01G436000	`PF24141`	LRR_ComC	107	201	0.003	18.0
TkA01G436000	`PF13516`	LRR_6	112	127	0.026	15.3
TkA01G436000	`PF00560`	LRR_1	114	135	2.7e-15	53.9
TkA01G436000	`PF12799`	LRR_4	136	174	3.7e-09	37.3
TkA01G436000	`PF00560`	LRR_1	137	159	2.7e-15	53.9
TkA01G436000	`PF13855`	LRR_8	137	194	9.5e-10	38.8
TkA01G436000	`PF13516`	LRR_6	138	149	0.026	15.3
TkA01G436000	`PF00560`	LRR_1	162	178	2.7e-15	53.9
TkA01G436000	`PF00560`	LRR_1	183	203	2.7e-15	53.9
TkA01G436000	`PF13855`	LRR_8	183	203	9.5e-10	38.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48788`	Arabidopsis thaliana	sp\|O48788\|Y2267_ARATH Probable inactive receptor kinase At2g26730	72.900%	Swiss-Prot	High
`Q9LVM0`	Arabidopsis thaliana	sp\|Q9LVM0\|Y5830_ARATH Probable inactive receptor kinase At5g58300	56.900%	Swiss-Prot	High
`Q9C9Y8`	Arabidopsis thaliana	sp\|Q9C9Y8\|Y3868_ARATH Probable inactive receptor kinase At3g08680	50.200%	Swiss-Prot	High
`Q9SUQ3`	Arabidopsis thaliana	sp\|Q9SUQ3\|Y4374_ARATH Probable inactive receptor kinase At4g23740	50.900%	Swiss-Prot	High
`Q9FHK7`	Arabidopsis thaliana	sp\|Q9FHK7\|Y5516_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g05160	48.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card