TkA01G420510 | RubberDandelionOmics

Gene overview

TkA01G420510

Reference: TK1151 Chr: Chr01 Coordinates: 105021621-105025045 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2492 bp · TkA01G420510|TK1151|cDNA

CTTCTTCCAACTCCCTTCGAGGGTTTCTTAATTTCTGAAACTCCACGAGGGAGATTATGTTTTGAACCAGGTGATCTCTAATCAAATATTATCCATGCAAGATTAAAAAAGGTATGATCAGGGAGTTACTCTTTGGTTTCCTGTTGATTCATTCATCTCTAGCCAAACATGGACACCCCGGTAATCACAAACCTACAAGACGGACCCGGTTGCAAGCTATGCCTGCTATTGTTCCTGGCACAGGCCCGGCCAAGAAATGG...

CDS

Download CDS FASTA

2328 bp · TkA01G420510|TK1151|CDS

ATGATCAGGGAGTTACTCTTTGGTTTCCTGTTGATTCATTCATCTCTAGCCAAACATGGACACCCCGGTAATCACAAACCTACAAGACGGACCCGGTTGCAAGCTATGCCTGCTATTGTTCCTGGCACAGGCCCGGCCAAGAAATGGCTAACATTGAACGGTGGGGAGCCGTTGGTGATAGCCCAAGGTGGGTCCCCGGGTTTATTCCCGGACTCGTCTGTGGCGGGCTATACTGCGGGTATAGCAATGGGCGTTATTGG...

Protein

Download Protein FASTA

775 aa · TkA01G420510|TK1151|PROTEIN

MIRELLFGFLLIHSSLAKHGHPGNHKPTRRTRLQAMPAIVPGTGPAKKWLTLNGGEPLVIAQGGSPGLFPDSSVAGYTAGIAMGVIGTLKYCNLQLTKDNLGVCLANIKMDNCTNAAERFPKHQRRYSVNGRDIDGWFPLDFTIDQIMKEIRLIQNIYSRASVFDFVYPLVQPDSVWGMEPKGHLWLNVQNDAFFSSHQLNVIRYIEDSNQFFVADYISSPEIGFLKAMAVSKSFDRTKTKLIFRFLKPVEVEPTYKETY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G420510`
TK1151 ID	TkA01G420510
OH-1004 ID	LXL04_002795
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 94.282 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G420510

Location Chr01:105021621-105025045 (+)

Description Similar to GDPDL7: Glycerophosphodiester phosphodiesterase GDPDL7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58050`	Glycerophosphodiester phosphodiesterase GDPDL6.	No verified direct reference in this release
`At5g58170`	Glycerophosphodiester phosphodiesterase GDPDL7.	No verified direct reference in this release
`At4g26690`	Involved in primary cell wall organization.	The glycerophosphoryl diester phosphodiesterase-like proteins SHV3 and its homologs play important roles in cell wall organization.2008 · DOI: 10.1093/pcp/pcn120
`At5g55480`	Involved in primary cell wall organization.	The glycerophosphoryl diester phosphodiesterase-like proteins SHV3 and its homologs play important roles in cell wall organization.2008 · DOI: 10.1093/pcp/pcn120
`At1g66970`	Hydrolyzes glycerolphosphoglycerol, glycerophosphocholine and glycerophosphoethanolamine in vitro.	Characterization of the Arabidopsis glycerophosphodiester phosphodiesterase (GDPD) family reveals a role of the plastid-localized AtGDPD1 in maintaining cellular phosphate homeostasis under phosphate starvation.2011 · DOI: 10.1111/j.1365-313x.2011.04538.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002795 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006071 glycerol metabolic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0006968 cellular defense response Biological Process

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0045087 innate immune response Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G66980

ath:AT4G26690

ath:AT5G55480

ath:AT5G58050

ath:AT5G58170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.620

Rank 1 · TkA01G420510 · TK1151

Cell membrane0.257

Rank 2 · TkA01G420510 · TK1151

Cytoplasm0.074

Rank 3 · TkA01G420510 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA01G420510 · TK1151

Golgi apparatus0.038

Rank 5 · TkA01G420510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03009GDPD65-118 aa

PF19682DUF618491-116 aa

PF03009GDPD294-353 aa

PF13653GDPD_2344-349 aa

PF03009GDPD380-668 aa

PF19682DUF6184398-423 aa

PF13653GDPD_2655-666 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G420510	`PF03009`	GDPD	65	118	7.7e-33	115.3
TkA01G420510	`PF19682`	DUF6184	91	116	0.54	11.3
TkA01G420510	`PF03009`	GDPD	294	353	7.7e-33	115.3
TkA01G420510	`PF13653`	GDPD_2	344	349	0.24	12.7
TkA01G420510	`PF03009`	GDPD	380	668	7.7e-33	115.3
TkA01G420510	`PF19682`	DUF6184	398	423	0.54	11.3
TkA01G420510	`PF13653`	GDPD_2	655	666	0.24	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGT9`	Arabidopsis thaliana	sp\|Q9FGT9\|GPDL6_ARATH Glycerophosphodiester phosphodiesterase GDPDL6	51.300%	Swiss-Prot	High
`Q9LVN0`	Arabidopsis thaliana	sp\|Q9LVN0\|GPDL7_ARATH Glycerophosphodiester phosphodiesterase GDPDL7	51.400%	Swiss-Prot	High
`Q9SZ11`	Arabidopsis thaliana	sp\|Q9SZ11\|GPDL3_ARATH Glycerophosphodiester phosphodiesterase GDPDL3	42.200%	Swiss-Prot	Medium
`Q9FJ62`	Arabidopsis thaliana	sp\|Q9FJ62\|GPDL4_ARATH Glycerophosphodiester phosphodiesterase GDPDL4	41.800%	Swiss-Prot	Medium
`Q7Y208`	Arabidopsis thaliana	sp\|Q7Y208\|GPDL1_ARATH Glycerophosphodiester phosphodiesterase GDPDL1	41.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card