TkA01G400520 | RubberDandelionOmics

Gene overview

TkA01G400520

Reference: TK1151 Chr: Chr01 Coordinates: 100065195-100066147 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

687 bp · TkA01G400520|TK1151|cDNA

ATGGAGGGTGTTGTGTACTCTATATCTAACTTTGGGCTTGATGAAAGATTTGGAGATGGTGATGCATGTGGTTTGGACCTTGATGAGGAATTAATGGTGGAGAAGGCCGAACATGCAATTGAGACATCAAATTCAGAGGTGATGCCAGTGCCAGCTGGCAACATTGTAAATAATCAGATAGAAGAGTATGATGGAGAGAATGAACCAATCGAGTATGCACATGCTCCATGTACACCTGGACTTTGGGAAGAACCAAATCT...

CDS

Download CDS FASTA

687 bp · TkA01G400520|TK1151|CDS

ATGGAGGGTGTTGTGTACTCTATATCTAACTTTGGGCTTGATGAAAGATTTGGAGATGGTGATGCATGTGGTTTGGACCTTGATGAGGAATTAATGGTGGAGAAGGCCGAACATGCAATTGAGACATCAAATTCAGAGGTGATGCCAGTGCCAGCTGGCAACATTGTAAATAATCAGATAGAAGAGTATGATGGAGAGAATGAACCAATCGAGTATGCACATGCTCCATGTACACCTGGACTTTGGGAAGAACCAAATCT...

Protein

Download Protein FASTA

228 aa · TkA01G400520|TK1151|PROTEIN

MEGVVYSISNFGLDERFGDGDACGLDLDEELMVEKAEHAIETSNSEVMPVPAGNIVNNQIEEYDGENEPIEYAHAPCTPGLWEEPNLSNIQETSADDDHQEPENHTITESAVKENLEKENISIDHQLHNNQFDPLEKSPPPIVTTPFPESNIVDQVKSMSPIPEMSETVNDPVKMVELLYKNAMQQASEVVQTVNNDREIYLANQENSFQHCYEIAKTSMSPFFLFFF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G400520`
TK1151 ID	TkA01G400520
OH-1004 ID	LXL04_012734
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.400
Protein coverage (%)	TK1151 94.298 / OH-1004 17.851 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G400520

Location Chr01:100065195-100066147 (-)

Description Similar to SYN4: Sister chromatid cohesion 1 protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16270`	Involved in sister chromatid and centromere cohesion during mitosis.	Cohesin gene defects may impair sister chromatid alignment and genome stability in Arabidopsis thaliana.2009 · DOI: 10.1007/s00412-009-0220-x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012734 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0009555 pollen development Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0051301 cell division Biological Process

GO:0070601 centromeric sister chromatid cohesion Biological Process

GO:1990414 replication-born double-strand break repair via sister chromatid exchange Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT3G59550

ath:AT5G16270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545

Rank 1 · TkA01G400520 · TK1151

Nucleus0.458

Rank 2 · TkA01G400520 · TK1151

Golgi apparatus0.052

Rank 3 · TkA01G400520 · TK1151

Cell membrane0.048

Rank 4 · TkA01G400520 · TK1151

Mitochondrion0.046

Rank 5 · TkA01G400520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W1Y0`	Arabidopsis thaliana	sp\|Q8W1Y0\|SSC14_ARATH Sister chromatid cohesion 1 protein 4	41.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card