TkA01G398970 | RubberDandelionOmics

Gene overview

TkA01G398970

Reference: TK1151 Chr: Chr01 Coordinates: 99561015-99562809 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

617 bp · TkA01G398970|TK1151|cDNA

ATGGCTTACGCCCTCATGGAGGGCATACCGTCCATTATTTGTCAGACGTACCTACTCTCAGCGCATCTCAGGAGTCCGTATTTCCTAAAAGGTTTGCAAAGAAGTGGAAACAGTTGCCGGTTAAGATGGATGAATTATCTTAACCCTAGTGTTAGAAGAGGCAACTTGTCTTACGAGGAGAAAGAAAAAATAATTCAACTTCATAGTGAATTGGGGAACAAATGGTCAACAATTGCAGCTCGTTTACCTGGAAGAACTGA...

CDS

Download CDS FASTA

354 bp · TkA01G398970|TK1151|CDS

ATGGCTTACGCCCTCATGGAGGGCATACCGTCCATTATTTGTCAGACGTACCTACTCTCAGCGCATCTCAGGAGTCCGTATTTCCTAAAAGGTTTGCAAAGAAGTGGAAACAGTTGCCGGTTAAGATGGATGAATTATCTTAACCCTAGTGTTAGAAGAGGCAACTTGTCTTACGAGGAGAAAGAAAAAATAATTCAACTTCATAGTGAATTGGGGAACAAATGGTCAACAATTGCAGCTCGTTTACCTGGAAGAACTGA...

Protein

Download Protein FASTA

117 aa · TkA01G398970|TK1151|PROTEIN

MAYALMEGIPSIICQTYLLSAHLRSPYFLKGLQRSGNSCRLRWMNYLNPSVRRGNLSYEEKEKIIQLHSELGNKWSTIAARLPGRTDNEIKNFFNNHLRKRIHSSPPSKTASPIPSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G398970`
TK1151 ID	TkA01G398970
OH-1004 ID	LXL04_010125
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.000
Protein coverage (%)	TK1151 61.538 / OH-1004 21.429 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G398970

Location Chr01:99561015-99562809 (+)

Description Similar to MYB102: Transcription factor MYB102

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21440`	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable).	Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.2003 · DOI: 10.1104/pp.102.019273 The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.2006 · DOI: 10.4161/psb.1.6.3512
`At4g05100`	Probable transcription factor that may function in salt stress response.	Salt-induced transcription factor MYB74 is regulated by the RNA-directed DNA methylation pathway in Arabidopsis.2015 · DOI: 10.1093/jxb/erv312
`At4g28110`	Transcription factor involved in salt stress response.	AtMyb41 regulates transcriptional and metabolic responses to osmotic stress in Arabidopsis.2009 · DOI: 10.1104/pp.108.134874 Phosphorylation by AtMPK6 is required for the biological function of AtMYB41 in Arabidopsis.2012 · DOI: 10.1016/j.bbrc.2012.04.137 AtMYB41 activates ectopic suberin synthesis and assembly in multiple plant species and cell types.2014 · DOI: 10.1111/tpj.12624
`At1g22640`	Transcription factor MYB3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010125 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009825 multidimensional cell growth Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

KEGG gene cross-reference

ath:AT1G34670

ath:AT4G05100

ath:AT4G17785

ath:AT4G21440

ath:AT4G28110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.746

Rank 1 · TkA01G398970 · TK1151

Cytoplasm0.272

Rank 2 · TkA01G398970 · TK1151

Mitochondrion0.063

Rank 3 · TkA01G398970 · TK1151

Cell membrane0.021

Rank 4 · TkA01G398970 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA01G398970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13921Myb_DNA-bind_630-55 aa

PF00249Myb_DNA-binding33-47 aa

PF00249Myb_DNA-binding53-98 aa

PF13921Myb_DNA-bind_657-108 aa

PF15963Myb_DNA-bind_757-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G398970	`PF13921`	Myb_DNA-bind_6	30	55	9.2e-16	58.5
TkA01G398970	`PF00249`	Myb_DNA-binding	33	47	3.2e-22	79.1
TkA01G398970	`PF00249`	Myb_DNA-binding	53	98	3.2e-22	79.1
TkA01G398970	`PF13921`	Myb_DNA-bind_6	57	108	9.2e-16	58.5
TkA01G398970	`PF15963`	Myb_DNA-bind_7	57	101	0.0062	17.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDR8`	Arabidopsis thaliana	sp\|Q9LDR8\|MY102_ARATH Transcription factor MYB102	73.600%	Swiss-Prot	Medium
`Q9M0Y5`	Arabidopsis thaliana	sp\|Q9M0Y5\|MYB74_ARATH Transcription factor MYB74	72.200%	Swiss-Prot	Medium
`Q9M0J5`	Arabidopsis thaliana	sp\|Q9M0J5\|MYB41_ARATH Transcription factor MYB41	70.800%	Swiss-Prot	Medium
`Q9S9K9`	Arabidopsis thaliana	sp\|Q9S9K9\|MYB3_ARATH Transcription factor MYB3	67.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card