TkA01G397020 | RubberDandelionOmics

Gene overview

TkA01G397020

Reference: TK1151 Chr: Chr01 Coordinates: 99004959-99008747 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1557 bp · TkA01G397020|TK1151|cDNA

CAGATGTTCCTTTGGGAAGCTTGGCAAAATTTGACACTTATTATCTTGATAGTAGCTGCTGCTGCATCACTGGTTCTAGGAATCAAAACAGAGGGTATTGAAGAAGGATGATACGATGGAGGAAGCATCACATCTGCTGTTCTTCTGGTTATTTTTGTGACACCAACCAGAGATTTTAGATAGTCCCTTCAGTTTCAGAATCTAAATGAGGAAAAGACTCGAGAAACATACTGATAGAGATAACTAGAGGTGGAAGAAGA...

CDS

Download CDS FASTA

666 bp · TkA01G397020|TK1151|CDS

ATGCTACGGGCTGGGCCATACATATGTGCAGAATGGGATTTTGGCGGTTTCCCTGCTTGGTTACTTACTAAAGAACCATCGATTAGACTTAGATCATCAGACCCAGTGTACTTCACTTTGGTTGATAAATGGTGGGGGACACTACTTCCAAAAATTGCCCTTCTTCTTTACCACAAAGGAGGCCCCATAGTTATGCTTCAGATGGCTCATGGTGGAACCAACTTTGGATTTTATAATGGTGTAAATGCTCAGGAGTCTGA...

Protein

Download Protein FASTA

221 aa · TkA01G397020|TK1151|PROTEIN

MLRAGPYICAEWDFGGFPAWLLTKEPSIRLRSSDPVYFTLVDKWWGTLLPKIALLLYHKGGPIVMLQMAHGGTNFGFYNGVNAQESESNYLADLTSYDYDARISESGYVDGAKFKALRSVIAMYSATSLSPVPKNNEKTGYGGIKLEKTSSLFDILDSSLLTKAIESDNPISMEVAGQMFGFLLYTSEYTAKRKGSTLYIPKVHDRAQVYVTCISMMLLNY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G397020`
TK1151 ID	TkA01G397020
OH-1004 ID	LXL04_003076
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.700
Protein coverage (%)	TK1151 92.308 / OH-1004 62.181 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G397020

Location Chr01:99004959-99008747 (+)

Description Similar to BGAL17: Beta-galactosidase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72990`	Beta-galactosidase 17.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0539400`	Beta-galactosidase 8.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003076 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006689 ganglioside catabolic process Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0042340 keratan sulfate proteoglycan catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G72990

bta:507188

dosa:Os05g0539400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.692

Rank 1 · TkA01G397020 · TK1151

Cytoplasm0.122

Rank 2 · TkA01G397020 · TK1151

Nucleus0.066

Rank 3 · TkA01G397020 · TK1151

Lysosome / Vacuole0.040

Rank 4 · TkA01G397020 · TK1151

Mitochondrion0.039

Rank 5 · TkA01G397020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01301Glyco_hydro_351-68 aa

PF01301Glyco_hydro_3567-123 aa

PF21317BetaGal_ABD_1170-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G397020	`PF01301`	Glyco_hydro_35	1	68	4.2e-39	135.7
TkA01G397020	`PF01301`	Glyco_hydro_35	67	123	4.2e-39	135.7
TkA01G397020	`PF21317`	BetaGal_ABD_1	170	212	1.2e-05	25.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z24`	Arabidopsis thaliana	sp\|Q93Z24\|BGA17_ARATH Beta-galactosidase 17	38.200%	Swiss-Prot	Medium
`Q0DGD7`	Oryza sativa subsp. japonica	sp\|Q0DGD7\|BGAL8_ORYSJ Beta-galactosidase 8	39.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card