TkA01G384610 | RubberDandelionOmics

Gene overview

TkA01G384610

Reference: TK1151 Chr: Chr01 Coordinates: 96008392-96010768 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1609 bp · TkA01G384610|TK1151|cDNA

CCATTTGCTATAGGTCGCGAGGCTGTGAGCCTCTAACCCTTAATCTACGGATGCTCTACTTTAATATCATTTCTCTATGCATGGAGAAATCCGAACGACAAAAGGTATCAAAACGGAAAGGTGGGCTAGATTTGATCAGTAAAATGCCCGATGCTATTCTTCTTTTGATTCTTTCACGTCTTCCATACACTGAAGAACAAATCCGAAGCAGCATTTTGTCCAGACGATGGAGGTATTTGTGGACTGCAGTTCCCTCGGTA...

CDS

Download CDS FASTA

1197 bp · TkA01G384610|TK1151|CDS

ATGCTCTACTTTAATATCATTTCTCTATGCATGGAGAAATCCGAACGACAAAAGGTATCAAAACGGAAAGGTGGGCTAGATTTGATCAGTAAAATGCCCGATGCTATTCTTCTTTTGATTCTTTCACGTCTTCCATACACTGAAGAACAAATCCGAAGCAGCATTTTGTCCAGACGATGGAGGTATTTGTGGACTGCAGTTCCCTCGGTAGACATGCAGCTTATATCCGGAGAAAAGTTAAAAAAATGTGAATTTAAAGA...

Protein

Download Protein FASTA

398 aa · TkA01G384610|TK1151|PROTEIN

MLYFNIISLCMEKSERQKVSKRKGGLDLISKMPDAILLLILSRLPYTEEQIRSSILSRRWRYLWTAVPSVDMQLISGEKLKKCEFKEFVYWVLASKTVDLDSFRLRLSDCDSIATVWRWVHLAVTRHVKQIDLSFSTIKNTEFIELPHYLVSCGSLEVLKLDLQNHVLGLPRSVGFPALRVLDLTHVDLPGNDDLVNDFLKRCPLLEDLSLVGCLLGKLVCISFPNLKRLRIINWDDMGCHSIEISCPKLVDFDLEGCIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G384610`
TK1151 ID	TkA01G384610
OH-1004 ID	LXL04_003226
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.400
Protein coverage (%)	TK1151 85.427 / OH-1004 32.106 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G384610

Location Chr01:96008392-96010768 (-)

Description Similar to At3g52680: F-box/FBD/LRR-repeat protein At3g52680

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26860`	FBD-associated F-box protein At2g26860.	No verified direct reference in this release
`At5g56370`	FBD-associated F-box protein At5g56370.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At4g14103`	F-box/LRR-repeat protein At4g14103.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003226 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G52680

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.833

Rank 1 · TkA01G384610 · TK1151

Cytoplasm0.209

Rank 2 · TkA01G384610 · TK1151

Cell membrane0.043

Rank 3 · TkA01G384610 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA01G384610 · TK1151

Plastid0.018

Rank 5 · TkA01G384610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box29-67 aa

PF12937F-box-like29-63 aa

PF23622LRR_At1g61320_AtMIF198-309 aa

PF24758LRR_At5g56370118-250 aa

PF12799LRR_4129-147 aa

PF12799LRR_4156-189 aa

PF12799LRR_4206-232 aa

PF24758LRR_At5g56370278-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G384610	`PF00646`	F-box	29	67	2.7e-07	30.9
TkA01G384610	`PF12937`	F-box-like	29	63	0.0035	17.8
TkA01G384610	`PF23622`	LRR_At1g61320_AtMIF1	98	309	8.1e-14	52.5
TkA01G384610	`PF24758`	LRR_At5g56370	118	250	6.5e-17	62.7
TkA01G384610	`PF12799`	LRR_4	129	147	0.0011	19.9
TkA01G384610	`PF12799`	LRR_4	156	189	0.0011	19.9
TkA01G384610	`PF12799`	LRR_4	206	232	0.0011	19.9
TkA01G384610	`PF24758`	LRR_At5g56370	278	331	6.5e-17	62.7
TkA01G384610	`PF12799`	LRR_4	293	305	0.0011	19.9
TkA01G384610	`PF12799`	LRR_4	296	330	0.0011	19.9
TkA01G384610	`PF23622`	LRR_At1g61320_AtMIF1	297	372	8.1e-14	52.5
TkA01G384610	`PF00646`	F-box	311	328	2.7e-07	30.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84X02`	Arabidopsis thaliana	sp\|Q84X02\|FBD7_ARATH FBD-associated F-box protein At2g26860	26.200%	Swiss-Prot	Low
`Q9FM94`	Arabidopsis thaliana	sp\|Q9FM94\|FBD21_ARATH FBD-associated F-box protein At5g56370	28.300%	Swiss-Prot	Low
`Q9FM89`	Arabidopsis thaliana	sp\|Q9FM89\|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420	32.000%	Swiss-Prot	Medium
`Q8L7H1`	Arabidopsis thaliana	sp\|Q8L7H1\|FBL75_ARATH F-box/LRR-repeat protein At4g14103	32.100%	Swiss-Prot	Medium
`Q6NKX3`	Arabidopsis thaliana	sp\|Q6NKX3\|FDL14_ARATH F-box/FBD/LRR-repeat protein At2g04230	32.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card