LXL04_003226 | RubberDandelionOmics

Gene overview

LXL04_003226

Reference: OH-1004 Chr: Chr01 Coordinates: 71462971-71477310 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3345 bp · LXL04_003226|LXL04_003226|OH1004|cDNA

ATGCTCTACTTTAATACCATTTCTCTATGCATGGAGAAATCCGAACGACAAAAGGTATCAAAACGGAAAGGTGGGCTAGATTTGATCAGTAAAATGCCCGATGCTATTCTTCTTTTGATTCTTTCACGTCTTCCATACACTGAAGAACAAATCTGAAGCAGCATTTTGTCCAGACGATGGAGGTATTTGTGGACTGCAGTTCCCTCGGTAGACATGCAGCTTATATCAGGAGAAAAGTTCAAAAAATGTGAATTTAAAGA...

CDS

Download CDS FASTA

3180 bp · LXL04_003226|LXL04_003226|OH1004|CDS

TTGTCCAGACGATGGAGGTATTTGTGGACTGCAGTTCCCTCGGTAGACATGCAGCTTATATCAGGAGAAAAGTTCAAAAAATGTGAATTTAAAGAGTTTGTGTATTGGGTTTTAGCAAGCAAAACCATAGATTTGGATAGCTTTCGTCTACGTTTATCTGATTGCGACAGCATAGCAACAGTCTGGCGGTGGGTTCATTTGGCAGTTACGAGACACGTCAAACAAATCGACCTTTCCTTTTCGACTATAAAGAACACTGA...

Protein

Download Protein FASTA

1059 aa · LXL04_003226|LXL04_003226|OH1004|PROTEIN

MSRRWRYLWTAVPSVDMQLISGEKFKKCEFKEFVYWVLASKTIDLDSFRLRLSDCDSIATVWRWVHLAVTRHVKQIDLSFSTIKNTEFIELPHYLVSCGSLEVLKLDLQNHVLGLPRSVGFPALRVLDLTYVDLPGDDLVNDFLKSCPLLEDLSLVGCLLGELVCISFPKLKRLRIINWDDVVCHSIEISCPKLVDFDLEGCILKGYSKPVQFLGNSHFKWAPFYFFWESIDAACDLPLPNLKTLVLRTTMKAFTVDELI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003226`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003226

Location Chr01:71462971-71477310 (+)

Description Similar to At3g52680: F-box/FBD/LRR-repeat protein At3g52680

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52680`	F-box/FBD/LRR-repeat protein At3g52680.	No verified direct reference in this release
`At2g04230`	F-box/FBD/LRR-repeat protein At2g04230.	No verified direct reference in this release
`At5g56560`	Putative FBD-associated F-box protein At5g56560.	No verified direct reference in this release
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release
`At3g26922`	F-box/LRR-repeat protein At3g26922.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003226 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G52680

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.580

Rank 1 · LXL04_003226 · OH-1004

Nucleus0.546

Rank 2 · LXL04_003226 · OH-1004

Endoplasmic reticulum0.050

Rank 3 · LXL04_003226 · OH-1004

Cell membrane0.044

Rank 4 · LXL04_003226 · OH-1004

Extracellular0.031

Rank 5 · LXL04_003226 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622.2LRR_At1g61320_AtMIF143-202 aa

PF24758.2LRR_At5g5637063-198 aa

PF00646.39F-box356-394 aa

PF12937.13F-box-like356-390 aa

PF23622.2LRR_At1g61320_AtMIF1424-585 aa

PF24758.2LRR_At5g56370445-560 aa

PF00646.39F-box679-716 aa

PF23622.2LRR_At1g61320_AtMIF1752-984 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003226	`PF23622.2`	LRR_At1g61320_AtMIF1	43	202	7.3e-31	108.6
LXL04_003226	`PF24758.2`	LRR_At5g56370	63	198	2e-48	165.8
LXL04_003226	`PF00646.39`	F-box	356	394	1.9e-11	44.1
LXL04_003226	`PF12937.13`	F-box-like	356	390	7.4e-09	36.0
LXL04_003226	`PF23622.2`	LRR_At1g61320_AtMIF1	424	585	7.3e-31	108.6
LXL04_003226	`PF24758.2`	LRR_At5g56370	445	560	2e-48	165.8
LXL04_003226	`PF00646.39`	F-box	679	716	1.9e-11	44.1
LXL04_003226	`PF23622.2`	LRR_At1g61320_AtMIF1	752	984	7.3e-31	108.6
LXL04_003226	`PF24758.2`	LRR_At5g56370	768	885	2e-48	165.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXJ6`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At3g52680	34.764%	Swiss-Prot	weak database homology
`Q6NKX3`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At2g04230	33.878%	Swiss-Prot	weak database homology
`Q9FJV2`	Arabidopsis thaliana	Putative FBD-associated F-box protein At5g56560	33.473%	Swiss-Prot	weak database homology
`Q9FWZ1`	Arabidopsis thaliana	F-box/LRR-repeat protein 13	33.333%	Swiss-Prot	weak database homology
`Q9LJF8`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g26922	31.837%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card