TkA01G381190 | RubberDandelionOmics

Gene overview

TkA01G381190

Reference: TK1151 Chr: Chr01 Coordinates: 95194297-95195364 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

540 bp · TkA01G381190|TK1151|cDNA

ACAGGTAACCCTAATACCCTATCACGTGCTTCACTCGTCGATCTTCCATCAATACCCGTTACTCCTCGGAGTCATTGCAATCATCGGCAACAACCTTTGTTCTTAATCAAATCTCCTTCGCTTCCCTGCCTCCGTCTACAGACGCATTCGATGGTGCCGCGGCTGAACTTATCGTTTGAAATTGAAGTCAAACAAGGCTTCACATCACCAAGAAACTACTTTACATTCACCCCTTTACTACCAAGTGTTACAGTTGGCAC...

CDS

Download CDS FASTA

540 bp · TkA01G381190|TK1151|CDS

ACAGGTAACCCTAATACCCTATCACGTGCTTCACTCGTCGATCTTCCATCAATACCCGTTACTCCTCGGAGTCATTGCAATCATCGGCAACAACCTTTGTTCTTAATCAAATCTCCTTCGCTTCCCTGCCTCCGTCTACAGACGCATTCGATGGTGCCGCGGCTGAACTTATCGTTTGAAATTGAAGTCAAACAAGGCTTCACATCACCAAGAAACTACTTTACATTCACCCCTTTACTACCAAGTGTTACAGTTGGCAC...

Protein

Download Protein FASTA

179 aa · TkA01G381190|TK1151|PROTEIN

TGNPNTLSRASLVDLPSIPVTPRSHCNHRQQPLFLIKSPSLPCLRLQTHSMVPRLNLSFEIEVKQGFTSPRNYFTFTPLLPSVTVGTVEARSVVEPIRNIVKKNVNVNYWEAECYRINAKNEKIYCRSSQDDKEEFVVDCDYLVVAMGARVNTFNTPGVEENCLYLKKNCLCLVCVVES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G381190`
TK1151 ID	TkA01G381190
OH-1004 ID	LXL04_034616
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	77.700
Protein coverage (%)	TK1151 62.011 / OH-1004 9.982 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G381190

Location Chr01:95194297-95195364 (+)

Description Similar to NDB2: External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05020`	Alternative NADH-ubiquinone oxidoreductase which catalyzes the oxidation of mitochondrial NADH does not translocate protons across the inner mitochondrial membrane (By similarity).	Ca2+-binding and Ca2+-independent respiratory NADH and NADPH dehydrogenases of Arabidopsis thaliana.2007 · DOI: 10.1074/jbc.m704674200
`At4g21490`	Alternative NADH-ubiquinone oxidoreductase which catalyzes the oxidation of mitochondrial NADH does not translocate protons across the inner mitochondrial membrane.	No verified direct reference in this release
`At4g28220`	Alternative NADH-ubiquinone oxidoreductase which catalyzes the oxidation of mitochondrial NADH does not translocate protons across the inner mitochondrial membrane (By similarity).	Ca2+-binding and Ca2+-independent respiratory NADH and NADPH dehydrogenases of Arabidopsis thaliana.2007 · DOI: 10.1074/jbc.m704674200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034616 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031314 extrinsic component of mitochondrial inner membrane Cellular Component

GO:0003954 NADH dehydrogenase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0009916 alternative oxidase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0120555 NADH dehydrogenase (ubiquinone) (non-electrogenic) activity Molecular Function

KEGG gene cross-reference

ath:AT2G20800

ath:AT4G05020

ath:AT4G21490

sot:102591773

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.422

Rank 1 · TkA01G381190 · TK1151

Nucleus0.285

Rank 2 · TkA01G381190 · TK1151

Mitochondrion0.143

Rank 3 · TkA01G381190 · TK1151

Plastid0.110

Rank 4 · TkA01G381190 · TK1151

Endoplasmic reticulum0.105

Rank 5 · TkA01G381190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992Pyr_redox_270-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G381190	`PF07992`	Pyr_redox_2	70	169	7.9e-09	36.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BV7`	Arabidopsis thaliana	sp\|Q94BV7\|NDB2_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial	61.500%	Swiss-Prot	Medium
`F4JJJ3`	Arabidopsis thaliana	sp\|F4JJJ3\|NDB3_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial	61.900%	Swiss-Prot	Medium
`Q1JPL4`	Arabidopsis thaliana	sp\|Q1JPL4\|NDB1_ARATH External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial	56.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card