LXL04_034616 | RubberDandelionOmics

Gene overview

LXL04_034616

Reference: OH-1004 Chr: Chr07 Coordinates: 110981730-110988601 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3409 bp · LXL04_034616|LXL04_034616|OH1004|cDNA

CCAAGTCATCTAGAAGATTCGCGTTCTCCCAACGCCAAAAACTCCATAAAACCCCTCACGATTTCCTCCCACATTCTTGGCAGCTGTCTTTcgtctctttctctctctaaaaATCCGAATTCTgagtttttgtttttatttttgcTAATTTGGATCCGATATGAGGAGTTCCAATTTCTACGAGAGGTTTTCTCAAGCGTTTCGTCAACATCCTTCTCTTTCGAGATTTCTCGTTGTTTCCTTCGTCAGTGGTGGGGGTC...

CDS

Download CDS FASTA

3249 bp · LXL04_034616|LXL04_034616|OH1004|CDS

ATGAGGAGTTCCAATTTCTACGAGAGGTTTTCTCAAGCGTTTCGTCAACATCCTTCTCTTTCGAGATTTCTCGTTGTTTCCTTCGTCAGTGGTGGGGGTCTTGTGGCTTATTCGGATGCAAATCTTCTAAGTAGTCCAAAGATCGATGAATTACCAGAGTCAGGCAACAAGAAAAAAAGGGTGGTGGTTCTTGGAACTGGTTGGGCTGCAACAAGTTTCTTGAGAAATTTGAAGGATCCATCATTCGATGTCCAAGTGGT...

Protein

Download Protein FASTA

1082 aa · LXL04_034616|LXL04_034616|OH1004|PROTEIN

MRSSNFYERFSQAFRQHPSLSRFLVVSFVSGGGLVAYSDANLLSSPKIDELPESGNKKKRVVVLGTGWAATSFLRNLKDPSFDVQVVSPRNYFAFTPLLPSVTVGTVEARSVVEPVRNIVKKKNVNVGFMEAECYKIDAKNKKVYCRSIQNENEEFIVDYDYLVVAMGARVNTFNTPGVEENCLYLKEVEDALKIRRTVIDCFEKASLPNISEDERKRMLQFVVVGGGPTGVEFAAELHDFVSEDLVRLYPAVKDLVKIS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034616`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034616

Location Chr07:110981730-110988601 (-)

Description Similar to NDB2: External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g05020`	Alternative NADH-ubiquinone oxidoreductase which catalyzes the oxidation of mitochondrial NADH does not translocate protons across the inner mitochondrial membrane (By similarity).	Ca2+-binding and Ca2+-independent respiratory NADH and NADPH dehydrogenases of Arabidopsis thaliana.2007 · DOI: 10.1074/jbc.m704674200
`At4g21490`	Alternative NADH-ubiquinone oxidoreductase which catalyzes the oxidation of mitochondrial NADH does not translocate protons across the inner mitochondrial membrane.	No verified direct reference in this release
`At2g20800`	Alternative NADH-ubiquinone oxidoreductase which catalyzes the oxidation of mitochondrial NADH does not translocate protons across the inner mitochondrial membrane (By similarity).	Ca2+-binding and Ca2+-independent respiratory NADH and NADPH dehydrogenases of Arabidopsis thaliana.2007 · DOI: 10.1074/jbc.m704674200 Alterations in the mitochondrial alternative NAD(P)H Dehydrogenase NDB4 lead to changes in mitochondrial electron transport chain composition, plant growth and response to oxidative stress.2011 · DOI: 10.1093/pcp/pcr073

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034616 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031314 extrinsic component of mitochondrial inner membrane Cellular Component

GO:0003954 NADH dehydrogenase activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

GO:0009916 alternative oxidase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0120555 NADH dehydrogenase (ubiquinone) (non-electrogenic) activity Molecular Function

KEGG gene cross-reference

ath:AT2G20800

ath:AT4G05020

ath:AT4G21490

sot:102591773

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.374

Rank 1 · LXL04_034616 · OH-1004

Cytoplasm0.208

Rank 2 · LXL04_034616 · OH-1004

Nucleus0.154

Rank 3 · LXL04_034616 · OH-1004

Plastid0.142

Rank 4 · LXL04_034616 · OH-1004

Peroxisome0.085

Rank 5 · LXL04_034616 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07992.21Pyr_redox_260-376 aa

PF00070.34Pyr_redox222-306 aa

PF00036.39EF-hand_1382-406 aa

PF22366.2NDH2_C514-575 aa

PF00447.24HSF_DNA-bind609-699 aa

PF00447.24HSF_DNA-bind841-885 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034616	`PF07992.21`	Pyr_redox_2	60	376	2.9e-52	178.6
LXL04_034616	`PF00070.34`	Pyr_redox	222	306	2.5e-11	44.6
LXL04_034616	`PF00036.39`	EF-hand_1	382	406	4.6e-06	26.5
LXL04_034616	`PF22366.2`	NDH2_C	514	575	2.7e-15	57.0
LXL04_034616	`PF00447.24`	HSF_DNA-bind	609	699	2.9e-28	99.0
LXL04_034616	`PF00447.24`	HSF_DNA-bind	841	885	2.9e-28	99.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94BV7`	Arabidopsis thaliana	External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial	74.182%	Swiss-Prot	moderate database homology
`F4JJJ3`	Arabidopsis thaliana	External alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial	72.806%	Swiss-Prot	moderate database homology
`Q9SKT7`	Arabidopsis thaliana	External alternative NAD(P)H-ubiquinone oxidoreductase B4, mitochondrial	65.983%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card