Gene Card
Gene overview
cDNA / CDS / Protein Sequences
639 bp · TkA01G366030|TK1151|cDNA
ATGACACTTCCACATCTTGAAACCCTGGTTGTTAAGAATTGTAATCTTACTGGTTCTTTGGTTTGGAGTTTGAGATCTCAGTGTAGTCGAGCACTCGTGGTCGTTGATTTGGCTGAAAATGGAGTTTCCGGCTCGTTTCACGATGCTTCAACATTCACGGCGTGTCCAAAGCTTAATACTCTGAACTTGTCAAGAAACTCGATTGATTTTAATGGCGGTTTGAAACCGATTGGAATTTCTGTTGAGGAGCTTCGACATTT...
639 bp · TkA01G366030|TK1151|CDS
ATGACACTTCCACATCTTGAAACCCTGGTTGTTAAGAATTGTAATCTTACTGGTTCTTTGGTTTGGAGTTTGAGATCTCAGTGTAGTCGAGCACTCGTGGTCGTTGATTTGGCTGAAAATGGAGTTTCCGGCTCGTTTCACGATGCTTCAACATTCACGGCGTGTCCAAAGCTTAATACTCTGAACTTGTCAAGAAACTCGATTGATTTTAATGGCGGTTTGAAACCGATTGGAATTTCTGTTGAGGAGCTTCGACATTT...
Protein
Download Protein FASTA212 aa · TkA01G366030|TK1151|PROTEIN
MTLPHLETLVVKNCNLTGSLVWSLRSQCSRALVVVDLAENGVSGSFHDASTFTACPKLNTLNLSRNSIDFNGGLKPIGISVEELRHLSVKGNKITGNLPEFDCPNLEYIDLFANNFSSGFPSFHDCSSLEYLDLSSNKFSGDISGALSSCKRLSFLNLTQNQFTCEISSFLVDSNIRRRPHRLKTKKWRVRLEKEYEEVHVAVHVALENFDY
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G366030 |
|---|---|
| TK1151 ID | TkA01G366030 |
| OH-1004 ID | LXL04_003380 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 96.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G366030 |
|---|---|
| Location | Chr01:91204162-91204878 (-) |
| Description | Similar to Systemin receptor SR160 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0001578 microtubule bundle formation Biological Process GO:0009414 response to water deprivation Biological Process GO:0009416 response to light stimulus Biological Process GO:0009647 skotomorphogenesis Biological Process GO:0009729 detection of brassinosteroid stimulus Biological Process GO:0009742 brassinosteroid mediated signaling pathway Biological Process GO:0009755 hormone-mediated signaling pathway Biological Process GO:0009791 post-embryonic development Biological Process GO:0009911 positive regulation of flower development Biological Process GO:0010224 response to UV-B Biological Process GO:0010268 brassinosteroid homeostasis Biological Process GO:0010584 pollen exine formation Biological Process |
| KEGG gene cross-reference | ath:AT4G39400 sly:101261320 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13516LRR_63-18 aaPF12799LRR_44-40 aaPF13855LRR_84-17 aaPF24758LRR_At5g563704-28 aaPF00560LRR_15-25 aaPF29594LRR_SKP26-88 aaPF29255LRR_NLRC326-95 aaPF12799LRR_432-69 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G366030 | PF13516 | LRR_6 | 3 | 18 | 7.8e-10 | 38.8 |
| TkA01G366030 | PF12799 | LRR_4 | 4 | 40 | 2.3e-20 | 72.8 |
| TkA01G366030 | PF13855 | LRR_8 | 4 | 17 | 5.6e-16 | 58.8 |
| TkA01G366030 | PF24758 | LRR_At5g56370 | 4 | 28 | 0.006 | 17.0 |
| TkA01G366030 | PF00560 | LRR_1 | 5 | 25 | 1.1e-15 | 55.1 |
| TkA01G366030 | PF29594 | LRR_SKP2 | 6 | 88 | 0.073 | 13.0 |
| TkA01G366030 | PF29255 | LRR_NLRC3 | 26 | 95 | 0.0087 | 15.5 |
| TkA01G366030 | PF12799 | LRR_4 | 32 | 69 | 2.3e-20 | 72.8 |
| TkA01G366030 | PF00560 | LRR_1 | 32 | 47 | 1.1e-15 | 55.1 |
| TkA01G366030 | PF13516 | LRR_6 | 32 | 43 | 7.8e-10 | 38.8 |
| TkA01G366030 | PF13855 | LRR_8 | 48 | 69 | 5.6e-16 | 58.8 |
| TkA01G366030 | PF24048 | LRR_NXF1-5 | 50 | 96 | 0.018 | 15.4 |
| TkA01G366030 | PF13306 | LRR_5 | 50 | 66 | 0.051 | 14.2 |
| TkA01G366030 | PF24758 | LRR_At5g56370 | 53 | 113 | 0.006 | 17.0 |
| TkA01G366030 | PF13516 | LRR_6 | 55 | 72 | 7.8e-10 | 38.8 |
| TkA01G366030 | PF00560 | LRR_1 | 57 | 72 | 1.1e-15 | 55.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.