LXL04_003380 | RubberDandelionOmics

Gene overview

LXL04_003380

Reference: OH-1004 Chr: Chr01 Coordinates: 77077042-77077758 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_003380|LXL04_003380|OH1004|cDNA

ATGACACTTCCACATCTTGAAACCCTGGTTGTTAAGAATTGTAATCTTACTGGTTCTTTGGTTTGGAGTTTGAGATCTCAGTGTAGTCGAGCACTCGTGGTCGTTGATTTGGCTGAAAATGGAGTTTCCGGCTCGTTTCACGATGCTTCAACATTCACGGCGTGTCCAAAGCTTAATACTCTGAACTTGTCAAGAAACTCGATTGATTTTAATGGCGGTTTGAAACCGATTGGAATTTCTGTTGAGTGGATCCTATCAAA...

CDS

Download CDS FASTA

663 bp · LXL04_003380|LXL04_003380|OH1004|CDS

ATGACACTTCCACATCTTGAAACCCTGGTTGTTAAGAATTGTAATCTTACTGGTTCTTTGGTTTGGAGTTTGAGATCTCAGTGTAGTCGAGCACTCGTGGTCGTTGATTTGGCTGAAAATGGAGTTTCCGGCTCGTTTCACGATGCTTCAACATTCACGGCGTGTCCAAAGCTTAATACTCTGAACTTGTCAAGAAACTCGATTGATTTTAATGGCGGTTTGAAACCGATTGGAATTTCTGTTGAGTGGATCCTATCAAA...

Protein

Download Protein FASTA

220 aa · LXL04_003380|LXL04_003380|OH1004|PROTEIN

MTLPHLETLVVKNCNLTGSLVWSLRSQCSRALVVVDLAENGVSGSFHDASTFTACPKLNTLNLSRNSIDFNGGLKPIGISVEWILSNGCQELRHLSVKGNKITGNLPEFDCPNLEYIDLFANNFSSGFPSFHDCSSLEYLDLSSNKFSGDISGALSSCKRLSFLNLTQNQFTCEISSFLVDSNIRRRPHRLKTKKWRVRLEKEYEEVHVAVHVALENFDY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003380`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003380

Location Chr01:77077042-77077758 (+)

Description Similar to Systemin receptor SR160

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39400`	Receptor with a dual specificity kinase activity acting on both serine/threonine- and tyrosine-containing substrates.	Brassinosteroid-insensitive dwarf mutants of Arabidopsis accumulate brassinosteroids.1999 · DOI: 10.1104/pp.121.3.743 Brassinosteroid-insensitive-1 is a ubiquitously expressed leucine-rich repeat receptor serine/threonine kinase.2000 · DOI: 10.1104/pp.123.4.1247 The Arabidopsis transthyretin-like protein is a potential substrate of BRASSINOSTEROID-INSENSITIVE 1.2004 · DOI: 10.1105/tpc.104.023903 The Arabidopsis thaliana brassinosteroid receptor (AtBRI1) contains a domain that functions as a guanylyl cyclase in vitro.2007 · DOI: 10.1371/journal.pone.0000449 BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 Tyrosine phosphorylation of the BRI1 receptor kinase emerges as a component of brassinosteroid signaling in Arabidopsis.2009 · DOI: 10.1073/pnas.0810249106 BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.2013 · DOI: 10.1111/tpj.12175
`At5g01890`	Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0718300`	Receptor kinase involved in brassinosteroid (BR) signal transduction.	Loss of function of a rice brassinosteroid insensitive1 homolog prevents internode elongation and bending of the lamina joint.2000 · DOI: 10.1105/tpc.12.9.1591 The role of OsBRI1 and its homologous genes, OsBRL1 and OsBRL3, in rice.2006 · DOI: 10.1104/pp.105.072330 OsBRI1 Activates BR Signaling by Preventing Binding between the TPR and Kinase Domains of OsBSK3 via Phosphorylation.2016 · DOI: 10.1104/pp.15.01668 OsREM4.1 Interacts with OsSERK1 to Coordinate the Interlinking between Abscisic Acid and Brassinosteroid Signaling in Rice.2016 · DOI: 10.1016/j.devcel.2016.06.011

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003380 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001578 microtubule bundle formation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009647 skotomorphogenesis Biological Process

GO:0009729 detection of brassinosteroid stimulus Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009755 hormone-mediated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010224 response to UV-B Biological Process

GO:0010268 brassinosteroid homeostasis Biological Process

GO:0010584 pollen exine formation Biological Process

KEGG gene cross-reference

ath:AT4G39400

sly:101261320

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.632

Rank 1 · LXL04_003380 · OH-1004

Endoplasmic reticulum0.147

Rank 2 · LXL04_003380 · OH-1004

Nucleus0.137

Rank 3 · LXL04_003380 · OH-1004

Cytoplasm0.105

Rank 4 · LXL04_003380 · OH-1004

Extracellular0.074

Rank 5 · LXL04_003380 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799.14LRR_491-125 aa

PF13855.13LRR_8130-171 aa

PF12799.14LRR_4136-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003380	`PF12799.14`	LRR_4	91	125	2.1e-20	73.0
LXL04_003380	`PF13855.13`	LRR_8	130	171	1.1e-16	61.1
LXL04_003380	`PF12799.14`	LRR_4	136	171	2.1e-20	73.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22476`	Arabidopsis thaliana	Protein BRASSINOSTEROID INSENSITIVE 1	40.230%	Swiss-Prot	moderate database homology
`Q9LZV7`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase PXC2	31.250%	Swiss-Prot	moderate database homology
`Q942F3`	Oryza sativa subsp. japonica	Brassinosteroid LRR receptor kinase BRI1	32.778%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card