TkA01G356380 | RubberDandelionOmics

Gene overview

TkA01G356380

Reference: TK1151 Chr: Chr01 Coordinates: 88480900-88482409 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1356 bp · TkA01G356380|TK1151|cDNA

TCGATCAAGCTCAATCTGCCTCTCCATGTCTATCTCCATTACAGACCCATCACCAAGATTTCGACCCCAAATAAACATGGTTGGAGGCATCCAAAAACCGATCGATTGTTTCCGGTGATATCCACGACATCAACCACTTCTAAACCGATAGAAACGACGAGTTCAATACGTGAAAAACAGAGCGAGATAAAGGATCAAAACAACTGGCCCAGCCTTTTAAAGCCGATGGATCCGCTTTTACGGTCTGAGCTAATACGTTA...

CDS

Download CDS FASTA

1356 bp · TkA01G356380|TK1151|CDS

TCGATCAAGCTCAATCTGCCTCTCCATGTCTATCTCCATTACAGACCCATCACCAAGATTTCGACCCCAAATAAACATGGTTGGAGGCATCCAAAAACCGATCGATTGTTTCCGGTGATATCCACGACATCAACCACTTCTAAACCGATAGAAACGACGAGTTCAATACGTGAAAAACAGAGCGAGATAAAGGATCAAAACAACTGGCCCAGCCTTTTAAAGCCGATGGATCCGCTTTTACGGTCTGAGCTAATACGTTA...

Protein

Download Protein FASTA

452 aa · TkA01G356380|TK1151|PROTEIN

SIKLNLPLHVYLHYRPITKISTPNKHGWRHPKTDRLFPVISTTSTTSKPIETTSSIREKQSEIKDQNNWPSLLKPMDPLLRSELIRYGEMAQACYDSFDNNPYSKYCGSCKVPPKTFFQDLEMMDLGYDITSYIYSSNTSNLIPNFFTKSIHPDGPWSPMVNWIGYVAISNYKTTARLGRRDITIAWRGTVTKLEWMEDLMNFLKPVSAQKLASRDPNIKVMAGFLHIYTDKDQSCPYSKFSAREQVLAELTRLTNIYAQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G356380`
TK1151 ID	TkA01G356380
OH-1004 ID	LXL04_003462
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 93.388 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G356380

Location Chr01:88480900-88482409 (-)

Description Similar to At1g06800: Phospholipase A1-Igamma1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06800`	Acylhydrolase with a broad specificity.	DONGLE and DEFECTIVE IN ANTHER DEHISCENCE1 lipases are not essential for wound- and pathogen-induced jasmonate biosynthesis: redundant lipases contribute to jasmonate formation.2010 · DOI: 10.1104/pp.110.155093
`At2g30550`	Acylhydrolase with broad specificity.	No verified direct reference in this release
`At1g51440`	Acylhydrolase that catalyzes the hydrolysis of phosphatidylcholine at the sn-1 position.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WY00`	Phospholipase that releases free fatty acids from phospholipids.	No verified direct reference in this release
`Os01g0900400`	Phospholipase that releases free fatty acids from phospholipids.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003462 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010582 floral meristem determinacy Biological Process

GO:0016042 lipid catabolic process Biological Process

GO:0048449 floral organ formation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004620 glycerophospholipase activity Molecular Function

GO:0004806 triacylglycerol lipase activity Molecular Function

GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function

GO:0047714 galactolipase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06800

ath:AT1G51440

ath:AT2G30550

dosa:Os01g0900400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.952

Rank 1 · TkA01G356380 · TK1151

Cytoplasm0.058

Rank 2 · TkA01G356380 · TK1151

Peroxisome0.044

Rank 3 · TkA01G356380 · TK1151

Mitochondrion0.042

Rank 4 · TkA01G356380 · TK1151

Lysosome / Vacuole0.026

Rank 5 · TkA01G356380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20414DUF669815-75 aa

PF11187Mbeg1-like175-215 aa

PF01764Lipase_3185-344 aa

PF11187Mbeg1-like245-310 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G356380	`PF20414`	DUF6698	15	75	0.064	13.6
TkA01G356380	`PF11187`	Mbeg1-like	175	215	6.8e-05	23.1
TkA01G356380	`PF01764`	Lipase_3	185	344	3.2e-33	115.3
TkA01G356380	`PF11187`	Mbeg1-like	245	310	6.8e-05	23.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q941F1`	Arabidopsis thaliana	sp\|Q941F1\|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic	56.300%	Swiss-Prot	High
`Q3EBR6`	Arabidopsis thaliana	sp\|Q3EBR6\|PLA16_ARATH Phospholipase A1-Igamma2, chloroplastic	54.700%	Swiss-Prot	High
`Q9C8J6`	Arabidopsis thaliana	sp\|Q9C8J6\|PLA17_ARATH Phospholipase A1-Igamma3, chloroplastic	53.100%	Swiss-Prot	High
`A2WY00`	Oryza sativa subsp. indica	sp\|A2WY00\|EG1_ORYSI Phospholipase A1 EG1, chloroplastic/mitochondrial	41.900%	Swiss-Prot	Medium
`Q8S1D9`	Oryza sativa subsp. japonica	sp\|Q8S1D9\|EG1_ORYSJ Phospholipase A1 EG1, chloroplastic/mitochondrial	41.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card